dashboardjavacloudcoapiotiot-analyticsiot-platformiot-solutionskafkalwm2mmicroservicesmiddlewaremqttnettyplatformsnmpthingsboardvisualizationwebsocketswidgets
You can not select more than 25 topics
Topics must start with a letter or number, can include dashes ('-') and can be up to 35 characters long.
2204 lines
146 KiB
2204 lines
146 KiB
#
|
|
# Copyright © 2016-2026 The Thingsboard Authors
|
|
#
|
|
# Licensed under the Apache License, Version 2.0 (the "License");
|
|
# you may not use this file except in compliance with the License.
|
|
# You may obtain a copy of the License at
|
|
#
|
|
# http://www.apache.org/licenses/LICENSE-2.0
|
|
#
|
|
# Unless required by applicable law or agreed to in writing, software
|
|
# distributed under the License is distributed on an "AS IS" BASIS,
|
|
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
|
|
# See the License for the specific language governing permissions and
|
|
# limitations under the License.
|
|
#
|
|
|
|
# Server common parameters
|
|
# Configures HTTP/HTTPS bind address, port, SSL, WebSocket, and REST API settings.
|
|
server:
|
|
# Server bind-address
|
|
address: "${HTTP_BIND_ADDRESS:0.0.0.0}"
|
|
# Server bind port
|
|
port: "${HTTP_BIND_PORT:8080}"
|
|
# Server forward headers strategy. Required for SWAGGER UI when reverse proxy is used
|
|
forward_headers_strategy: "${HTTP_FORWARD_HEADERS_STRATEGY:framework}"
|
|
# Server SSL configuration
|
|
ssl:
|
|
# Enable/disable SSL support
|
|
enabled: "${SSL_ENABLED:false}"
|
|
# Server SSL credentials
|
|
credentials:
|
|
# Server credentials type (PEM - pem certificate file; KEYSTORE - java keystore)
|
|
type: "${SSL_CREDENTIALS_TYPE:PEM}"
|
|
# PEM server credentials
|
|
pem:
|
|
# Path to the server certificate file (holds server certificate or certificate chain, may include server private key)
|
|
cert_file: "${SSL_PEM_CERT:server.pem}"
|
|
# Path to the server certificate private key file (optional). Required if the private key is not present in the server certificate file
|
|
key_file: "${SSL_PEM_KEY:server_key.pem}"
|
|
# Server certificate private key password (optional)
|
|
key_password: "${SSL_PEM_KEY_PASSWORD:server_key_password}"
|
|
# Keystore server credentials
|
|
keystore:
|
|
# Type of the key store (JKS or PKCS12)
|
|
type: "${SSL_KEY_STORE_TYPE:PKCS12}"
|
|
# Path to the key store that holds the SSL certificate
|
|
store_file: "${SSL_KEY_STORE:classpath:keystore/keystore.p12}"
|
|
# Password used to access the key store
|
|
store_password: "${SSL_KEY_STORE_PASSWORD:thingsboard}"
|
|
# Key alias
|
|
key_alias: "${SSL_KEY_ALIAS:tomcat}"
|
|
# Password used to access the key
|
|
key_password: "${SSL_KEY_PASSWORD:thingsboard}"
|
|
# HTTP settings
|
|
http:
|
|
# Semi-colon-separated list of urlPattern=maxPayloadSize pairs that define max http request size for specified url pattern. After first match all other will be skipped
|
|
max_payload_size: "${HTTP_MAX_PAYLOAD_SIZE_LIMIT_CONFIGURATION:/api/image*/**=52428800;/api/resource/**=52428800;/api/**=16777216}"
|
|
# HTTP/2 support (takes effect only if server SSL is enabled)
|
|
http2:
|
|
# Enable/disable HTTP/2 support
|
|
enabled: "${HTTP2_ENABLED:true}"
|
|
# Log errors with stacktrace when REST API throws an exception with the message "Please contact sysadmin"
|
|
log_controller_error_stack_trace: "${HTTP_LOG_CONTROLLER_ERROR_STACK_TRACE:false}"
|
|
ws:
|
|
# Timeout for sending data to client WebSocket session in milliseconds
|
|
send_timeout: "${TB_SERVER_WS_SEND_TIMEOUT:5000}"
|
|
# recommended timeout >= 30 seconds. The platform will attempt to send a 'ping' request 3 times within the timeout
|
|
ping_timeout: "${TB_SERVER_WS_PING_TIMEOUT:30000}"
|
|
dynamic_page_link:
|
|
# Refresh rate of the dynamic alarm end entity data queries
|
|
refresh_interval: "${TB_SERVER_WS_DYNAMIC_PAGE_LINK_REFRESH_INTERVAL_SEC:60}"
|
|
# Thread pool size to execute dynamic queries
|
|
refresh_pool_size: "${TB_SERVER_WS_DYNAMIC_PAGE_LINK_REFRESH_POOL_SIZE:1}"
|
|
# Maximum number of dynamic queries per refresh interval. For example, no more than 10 alarm queries are executed by the user simultaneously in all browsers.
|
|
max_alarm_queries_per_refresh_interval: "${TB_SERVER_WS_MAX_ALARM_QUERIES_PER_REFRESH_INTERVAL:10}"
|
|
# Maximum number of dynamic queries per user. For example, no more than 10 alarm widgets opened by the user simultaneously in all browsers
|
|
max_per_user: "${TB_SERVER_WS_DYNAMIC_PAGE_LINK_MAX_PER_USER:10}"
|
|
# Maximum number of entities returned for single entity subscription. For example, no more than 10,000 entities on the map widget
|
|
max_entities_per_data_subscription: "${TB_SERVER_WS_MAX_ENTITIES_PER_DATA_SUBSCRIPTION:10000}"
|
|
# Maximum number of alarms returned for single alarm subscription. For example, no more than 10,000 alarms on the alarm widget
|
|
max_entities_per_alarm_subscription: "${TB_SERVER_WS_MAX_ENTITIES_PER_ALARM_SUBSCRIPTION:10000}"
|
|
# Maximum size (bytes) of incoming WS text message
|
|
max_text_message_buffer_size: "${TB_SERVER_WS_MAX_TEXT_MESSAGE_BUFFER_SIZE:32768}"
|
|
# Maximum size (bytes) of incoming WS binary message
|
|
max_binary_message_buffer_size: "${TB_SERVER_WS_MAX_BINARY_MESSAGE_BUFFER_SIZE:32768}"
|
|
# Maximum queue size of the websocket updates per session. This restriction prevents infinite updates of WS
|
|
max_queue_messages_per_session: "${TB_SERVER_WS_DEFAULT_QUEUE_MESSAGES_PER_SESSION:1000}"
|
|
# Maximum time between WS session opening and sending auth command
|
|
auth_timeout_ms: "${TB_SERVER_WS_AUTH_TIMEOUT_MS:10000}"
|
|
rate_limits:
|
|
# Per-tenant rate limit for WS subscriptions
|
|
subscriptions_per_tenant: "${TB_SERVER_WS_SUBSCRIPTIONS_PER_TENANT_RATE_LIMIT:}"
|
|
# Per-user rate limit for WS subscriptions
|
|
subscriptions_per_user: "${TB_SERVER_WS_SUBSCRIPTIONS_PER_USER_RATE_LIMIT:}"
|
|
# Maximum number of active originator alarm ids being saved in cache for single alarm status subscription. For example, no more than 10 alarm ids on the alarm widget
|
|
alarms_per_alarm_status_subscription_cache_size: "${TB_ALARMS_PER_ALARM_STATUS_SUBSCRIPTION_CACHE_SIZE:10}"
|
|
rest:
|
|
server_side_rpc:
|
|
# Minimum value of the server-side RPC timeout. May override value provided in the REST API call.
|
|
# Since 2.5 migration to queues, the RPC delay depends on the size of the pending messages in the queue.
|
|
# So default UI parameter of 500ms may not be sufficient for loaded environments.
|
|
min_timeout: "${MIN_SERVER_SIDE_RPC_TIMEOUT:5000}"
|
|
# Default value of the server-side RPC timeout.
|
|
default_timeout: "${DEFAULT_SERVER_SIDE_RPC_TIMEOUT:10000}"
|
|
rate_limits:
|
|
# Limit that prohibits resetting the password for the user too often. The value of the rate limit. By default, no more than 5 requests per hour
|
|
reset_password_per_user: "${RESET_PASSWORD_PER_USER_RATE_LIMIT_CONFIGURATION:5:3600}"
|
|
rule_engine:
|
|
# Default timeout for waiting response of REST API request to Rule Engine in milliseconds
|
|
response_timeout: "${DEFAULT_RULE_ENGINE_RESPONSE_TIMEOUT:10000}"
|
|
|
|
# Application info parameters
|
|
# Exposes application metadata such as version string injected at build time.
|
|
app:
|
|
# Application version
|
|
version: "@project.version@"
|
|
|
|
# ZooKeeper connection parameters
|
|
# Controls ZooKeeper-based service discovery and cluster coordination for microservice deployments.
|
|
zk:
|
|
# Enable/disable ZooKeeper discovery service.
|
|
enabled: "${ZOOKEEPER_ENABLED:false}"
|
|
# ZooKeeper connect string
|
|
url: "${ZOOKEEPER_URL:localhost:2181}"
|
|
# ZooKeeper retry interval in milliseconds
|
|
retry_interval_ms: "${ZOOKEEPER_RETRY_INTERVAL_MS:3000}"
|
|
# ZooKeeper connection timeout in milliseconds
|
|
connection_timeout_ms: "${ZOOKEEPER_CONNECTION_TIMEOUT_MS:3000}"
|
|
# ZooKeeper session timeout in milliseconds
|
|
session_timeout_ms: "${ZOOKEEPER_SESSION_TIMEOUT_MS:3000}"
|
|
# Name of the directory in ZooKeeper 'filesystem'
|
|
zk_dir: "${ZOOKEEPER_NODES_DIR:/thingsboard}"
|
|
# The recalculate_delay property is recommended in a microservices architecture setup for rule-engine services.
|
|
# This property provides a pause to ensure that when a rule-engine service is restarted, other nodes don't immediately attempt to recalculate their partitions.
|
|
# The delay is recommended because the initialization of rule chain actors is time-consuming. Avoiding unnecessary recalculations during a restart can enhance system performance and stability.
|
|
recalculate_delay: "${ZOOKEEPER_RECALCULATE_DELAY_MS:0}"
|
|
|
|
# Cluster parameters
|
|
# Controls cluster statistics — tracks the number of messages exchanged between cluster nodes.
|
|
cluster:
|
|
stats:
|
|
# Enable/Disable the cluster statistics. Calculates the number of messages sent between cluster nodes based on each type
|
|
enabled: "${TB_CLUSTER_STATS_ENABLED:false}"
|
|
# Interval of printing the cluster stats to the log file
|
|
print_interval_ms: "${TB_CLUSTER_STATS_PRINT_INTERVAL_MS:10000}"
|
|
|
|
# Plugins configuration parameters
|
|
# Defines classpath scan packages used to discover and register ThingsBoard extension plugins.
|
|
plugins:
|
|
# Comma-separated package list used during classpath scanning for plugins
|
|
scan_packages: "${PLUGINS_SCAN_PACKAGES:org.thingsboard.server.extensions,org.thingsboard.rule.engine}"
|
|
|
|
# Security parameters
|
|
# Configures JWT tokens, user login, device claiming, OAuth2, and CA certificate trust store.
|
|
security:
|
|
# JWT Token parameters
|
|
jwt: # Since 3.4.2 values are persisted in the database during installation or upgrade. On Install, the key will be generated randomly if no custom value set. You can change it later from Web UI under SYS_ADMIN
|
|
tokenExpirationTime: "${JWT_TOKEN_EXPIRATION_TIME:9000}" # Number of seconds (2.5 hours)
|
|
refreshTokenExpTime: "${JWT_REFRESH_TOKEN_EXPIRATION_TIME:604800}" # Number of seconds (1 week).
|
|
tokenIssuer: "${JWT_TOKEN_ISSUER:thingsboard.io}" # User JWT Token issuer
|
|
tokenSigningKey: "${JWT_TOKEN_SIGNING_KEY:thingsboardDefaultSigningKey}" # Base64 encoded
|
|
# Enable/disable access to Tenant Administrators JWT token by System Administrator or Customer Users JWT token by Tenant Administrator
|
|
user_token_access_enabled: "${SECURITY_USER_TOKEN_ACCESS_ENABLED:true}"
|
|
# API key parameters
|
|
api_key:
|
|
# Prefix for the auto-generated API key. For example, tb_Ood4dQMxWvMH-76z3E_Cv0mZaBWT0Clk3hRSO0P_jNQ
|
|
value_prefix: "${SECURITY_API_KEY_VALUE_PREFIX:tb_}"
|
|
# Length of the auto-generated API key. Max is 255
|
|
value_bytes_size: "${SECURITY_API_KEY_VALUE_PREFIX:64}"
|
|
# Enable/disable case-sensitive username login
|
|
user_login_case_sensitive: "${SECURITY_USER_LOGIN_CASE_SENSITIVE:true}"
|
|
claim:
|
|
# Enable/disable claiming devices; if false -> the device's [claimingAllowed] SERVER_SCOPE attribute must be set to [true] to allow claiming the specific device
|
|
allowClaimingByDefault: "${SECURITY_CLAIM_ALLOW_CLAIMING_BY_DEFAULT:true}"
|
|
# Time allowed to claim the device in milliseconds
|
|
duration: "${SECURITY_CLAIM_DURATION:86400000}" # 1 minute, note this value must equal claimDevices.timeToLiveInMinutes value
|
|
basic:
|
|
# Enable/Disable basic security options
|
|
enabled: "${SECURITY_BASIC_ENABLED:false}"
|
|
oauth2:
|
|
# Redirect URL where access code from external user management system will be processed
|
|
loginProcessingUrl: "${SECURITY_OAUTH2_LOGIN_PROCESSING_URL:/login/oauth2/code/}"
|
|
githubMapper:
|
|
# The email addresses that will be mapped from the URL
|
|
emailUrl: "${SECURITY_OAUTH2_GITHUB_MAPPER_EMAIL_URL_KEY:https://api.github.com/user/emails}"
|
|
java_cacerts:
|
|
# CA certificates keystore default path. Typically this keystore is at JAVA_HOME/lib/security/cacerts
|
|
path: "${SECURITY_JAVA_CACERTS_PATH:${java.home}/lib/security/cacerts}"
|
|
# The password of the cacerts keystore file
|
|
password: "${SECURITY_JAVA_CACERTS_PASSWORD:changeit}"
|
|
# HTTP security response headers configuration.
|
|
# These headers are set on responses from the ThingsBoard backend (tb-node).
|
|
# In microservice deployments, the web-ui (Express.js) has its own header configuration
|
|
# under msa/web-ui/config/ using the same environment variable names.
|
|
headers:
|
|
# X-Content-Type-Options header prevents browsers from MIME-sniffing the Content-Type.
|
|
# Safe to enable. Only disable if you intentionally serve resources with mismatched Content-Type.
|
|
x-content-type-options:
|
|
# Enable/disable X-Content-Type-Options header. Prevents browsers from MIME-sniffing the Content-Type
|
|
enabled: "${SECURITY_HEADERS_X_CONTENT_TYPE_OPTIONS_ENABLED:true}"
|
|
# Referrer-Policy header controls how much referrer info the browser sends with requests.
|
|
# The default 'strict-origin-when-cross-origin' matches the browser's built-in default,
|
|
# so enabling this does not change existing behavior — it just makes the policy explicit.
|
|
# Valid values: no-referrer, no-referrer-when-downgrade, origin, origin-when-cross-origin,
|
|
# same-origin, strict-origin, strict-origin-when-cross-origin, unsafe-url
|
|
referrer-policy:
|
|
# Enable/disable Referrer-Policy header
|
|
enabled: "${SECURITY_HEADERS_REFERRER_POLICY_ENABLED:true}"
|
|
# Referrer-Policy header value
|
|
value: "${SECURITY_HEADERS_REFERRER_POLICY_VALUE:strict-origin-when-cross-origin}"
|
|
# X-Frame-Options header protects against clickjacking attacks by preventing the page
|
|
# from being loaded in iframes on other domains.
|
|
# Disabled by default because ThingsBoard supports multi-domain deployments where
|
|
# the platform may be embedded in iframes on customer domains.
|
|
# WARNING: Enabling with DENY will block ALL iframe embedding including dashboards
|
|
# embedded on external sites. Use SAMEORIGIN to allow same-domain iframes only.
|
|
x-frame-options:
|
|
# Enable/disable X-Frame-Options header. Protects against clickjacking attacks
|
|
enabled: "${SECURITY_HEADERS_X_FRAME_OPTIONS_ENABLED:false}"
|
|
# Valid values: DENY, SAMEORIGIN
|
|
value: "${SECURITY_HEADERS_X_FRAME_OPTIONS_VALUE:SAMEORIGIN}"
|
|
# Content-Security-Policy header mitigates XSS and data injection attacks by restricting
|
|
# which resources the browser is allowed to load.
|
|
# Disabled by default because ThingsBoard supports multi-domain deployments and
|
|
# because custom HTML Card widgets may use inline scripts, inline styles, and
|
|
# external resources that a restrictive CSP would block.
|
|
# WARNING when enabling: A strict CSP (e.g. script-src 'self') will break:
|
|
# - HTML Card widgets with inline JavaScript
|
|
# - Custom widget types with inline scripts/styles
|
|
# - Widgets loading external resources (images, fonts, scripts)
|
|
# - Dashboard embedding via iframes (if frame-ancestors is restrictive)
|
|
# Use 'report-only: true' first to test the impact before enforcing.
|
|
# Example value: "default-src 'self'; script-src 'self' 'unsafe-inline' 'unsafe-eval'; style-src 'self' 'unsafe-inline'; frame-ancestors 'self'"
|
|
content-security-policy:
|
|
# Enable/disable Content-Security-Policy header. Mitigates XSS and data injection attacks
|
|
enabled: "${SECURITY_HEADERS_CONTENT_SECURITY_POLICY_ENABLED:false}"
|
|
# Full CSP directive string
|
|
value: "${SECURITY_HEADERS_CONTENT_SECURITY_POLICY_VALUE:}"
|
|
# If true, uses Content-Security-Policy-Report-Only header instead — the browser
|
|
# reports violations but does not enforce them. Use for testing before enforcing.
|
|
report-only: "${SECURITY_HEADERS_CONTENT_SECURITY_POLICY_REPORT_ONLY:false}"
|
|
|
|
# Mail settings parameters
|
|
# Configures mail service OAuth2 token refresh and per-tenant sending rate limits.
|
|
mail:
|
|
oauth2:
|
|
# Interval for checking refresh token expiration in seconds(by default, 1 day).
|
|
refreshTokenCheckingInterval: "${REFRESH_TOKEN_EXPIRATION_CHECKING_INTERVAL:86400}"
|
|
# Rate limits for sending mails per tenant. As example for 1000 per minute and 10000 per hour is "1000:60,10000:3600"
|
|
per_tenant_rate_limits: "${MAIL_PER_TENANT_RATE_LIMITS:}"
|
|
|
|
# Usage statistics parameters
|
|
# Controls collection and reporting intervals for API usage stats at system, tenant, and customer levels.
|
|
usage:
|
|
stats:
|
|
report:
|
|
# Enable/Disable the collection of API usage statistics. Collected on a system and tenant level by default
|
|
enabled: "${USAGE_STATS_REPORT_ENABLED:true}"
|
|
# Enable/Disable the collection of API usage statistics on a customer level
|
|
enabled_per_customer: "${USAGE_STATS_REPORT_PER_CUSTOMER_ENABLED:false}"
|
|
# Statistics reporting interval, set to send summarized data every 10 seconds by default
|
|
interval: "${USAGE_STATS_REPORT_INTERVAL:60}"
|
|
# Reporting interval for urgent keys (e.g. SMS, Email) that require quicker usage state updates
|
|
urgent_interval: "${USAGE_STATS_REPORT_URGENT_INTERVAL:10}"
|
|
# Amount of statistic messages in pack
|
|
pack_size: "${USAGE_STATS_REPORT_PACK_SIZE:1024}"
|
|
check:
|
|
# Interval of checking the start of the next cycle and re-enabling the blocked tenants/customers
|
|
cycle: "${USAGE_STATS_CHECK_CYCLE:60000}"
|
|
# In milliseconds. The default value is 3 minutes
|
|
gauge_report_interval: "${USAGE_STATS_GAUGE_REPORT_INTERVAL:180000}"
|
|
devices:
|
|
# In seconds, the default value is 1 minute. When changing, in cluster mode, make sure usage.stats.gauge_report_interval is set to x2-x3 of this value
|
|
report_interval: "${DEVICES_STATS_REPORT_INTERVAL:60}"
|
|
|
|
# UI settings parameters
|
|
# Configures dashboard data limits and base URL for UI help assets.
|
|
ui:
|
|
# Dashboard parameters
|
|
dashboard:
|
|
# Maximum allowed datapoints fetched by widgets
|
|
max_datapoints_limit: "${DASHBOARD_MAX_DATAPOINTS_LIMIT:50000}"
|
|
# Help parameters
|
|
help:
|
|
# Base URL for UI help assets
|
|
base-url: "${UI_HELP_BASE_URL:https://raw.githubusercontent.com/thingsboard/thingsboard-ui-help/release-4.4}"
|
|
|
|
# Database telemetry parameters
|
|
# Selects the storage backend (SQL, Cassandra, or TimescaleDB) for time-series and latest telemetry data.
|
|
database:
|
|
ts_max_intervals: "${DATABASE_TS_MAX_INTERVALS:700}" # Max number of DB queries generated by a single API call to fetch telemetry records
|
|
ts:
|
|
type: "${DATABASE_TS_TYPE:sql}" # cassandra, sql, or timescale (for hybrid mode, DATABASE_TS_TYPE value should be cassandra, or timescale)
|
|
ts_latest:
|
|
type: "${DATABASE_TS_LATEST_TYPE:sql}" # cassandra, sql, or timescale (for hybrid mode, DATABASE_TS_TYPE value should be cassandra, or timescale)
|
|
|
|
# Cassandra driver configuration parameters
|
|
# Configures cluster name, keyspace, SSL, credentials, socket, and query settings for the Cassandra driver.
|
|
cassandra:
|
|
# Thingsboard cluster name
|
|
cluster_name: "${CASSANDRA_CLUSTER_NAME:Thingsboard Cluster}"
|
|
# Thingsboard keyspace name
|
|
keyspace_name: "${CASSANDRA_KEYSPACE_NAME:thingsboard}"
|
|
# Specify node list
|
|
url: "${CASSANDRA_URL:127.0.0.1:9042}"
|
|
# Specify the local data center name
|
|
local_datacenter: "${CASSANDRA_LOCAL_DATACENTER:datacenter1}"
|
|
ssl:
|
|
# Enable/disable secure connection
|
|
enabled: "${CASSANDRA_USE_SSL:false}"
|
|
# Enable/disable validation of Cassandra server hostname
|
|
# If enabled, the hostname of the Cassandra server must match the CN of the server certificate
|
|
hostname_validation: "${CASSANDRA_SSL_HOSTNAME_VALIDATION:true}"
|
|
# Set trust store for client authentication of the server (optional, uses trust store from default SSLContext if not set)
|
|
trust_store: "${CASSANDRA_SSL_TRUST_STORE:}"
|
|
# The password for Cassandra trust store key
|
|
trust_store_password: "${CASSANDRA_SSL_TRUST_STORE_PASSWORD:}"
|
|
# Set key store for server authentication of the client (optional, uses key store from default SSLContext if not set)
|
|
# A key store is only needed if the Cassandra server requires client authentication
|
|
key_store: "${CASSANDRA_SSL_KEY_STORE:}"
|
|
# The password for the Cassandra key store
|
|
key_store_password: "${CASSANDRA_SSL_KEY_STORE_PASSWORD:}"
|
|
# Comma-separated list of cipher suites (optional, uses Java default cipher suites if not set)
|
|
cipher_suites: "${CASSANDRA_SSL_CIPHER_SUITES:}"
|
|
# Enable/disable JMX
|
|
jmx: "${CASSANDRA_USE_JMX:false}"
|
|
# Enable/disable metrics collection.
|
|
metrics: "${CASSANDRA_USE_METRICS:false}"
|
|
# NONE SNAPPY LZ4
|
|
compression: "${CASSANDRA_COMPRESSION:none}"
|
|
# Specify cassandra cluster initialization timeout in milliseconds (if no hosts are available during startup)
|
|
init_timeout_ms: "${CASSANDRA_CLUSTER_INIT_TIMEOUT_MS:300000}"
|
|
# Specify cassandra cluster initialization retry interval (if no hosts available during startup)
|
|
init_retry_interval_ms: "${CASSANDRA_CLUSTER_INIT_RETRY_INTERVAL_MS:3000}"
|
|
# Cassandra max local requests per connection
|
|
max_requests_per_connection_local: "${CASSANDRA_MAX_REQUESTS_PER_CONNECTION_LOCAL:32768}"
|
|
# Cassandra max remote requests per connection
|
|
max_requests_per_connection_remote: "${CASSANDRA_MAX_REQUESTS_PER_CONNECTION_REMOTE:32768}"
|
|
# Credential parameters
|
|
credentials: "${CASSANDRA_USE_CREDENTIALS:false}"
|
|
# Specify your username
|
|
username: "${CASSANDRA_USERNAME:}"
|
|
# Specify your password
|
|
password: "${CASSANDRA_PASSWORD:}"
|
|
# Astra DB connect https://astra.datastax.com/
|
|
cloud:
|
|
# /etc/thingsboard/astra/secure-connect-thingsboard.zip
|
|
secure_connect_bundle_path: "${CASSANDRA_CLOUD_SECURE_BUNDLE_PATH:}"
|
|
# DucitQPHMzPCBOZqFYexAfKk
|
|
client_id: "${CASSANDRA_CLOUD_CLIENT_ID:}"
|
|
# ZnF7FpuHp43FP5BzM+KY8wGmSb4Ql6BhT4Z7sOU13ze+gXQ-n7OkFpNuB,oACUIQObQnK0g4bSPoZhK5ejkcF9F.j6f64j71Sr.tiRe0Fsq2hPS1ZCGSfAaIgg63IydG
|
|
client_secret: "${CASSANDRA_CLOUD_CLIENT_SECRET:}"
|
|
|
|
# Cassandra cluster connection socket parameters #
|
|
socket:
|
|
# Sets the timeout, in milliseconds, of a native connection from ThingsBoard to Cassandra. The default value is 5000
|
|
connect_timeout: "${CASSANDRA_SOCKET_TIMEOUT:5000}"
|
|
# Timeout before closing the connection. Value set in milliseconds
|
|
read_timeout: "${CASSANDRA_SOCKET_READ_TIMEOUT:20000}"
|
|
# Gets if TCP keep-alive must be used
|
|
keep_alive: "${CASSANDRA_SOCKET_KEEP_ALIVE:true}"
|
|
# Enable/Disable reuse-address. The socket option allows for the reuse of local addresses and ports
|
|
reuse_address: "${CASSANDRA_SOCKET_REUSE_ADDRESS:true}"
|
|
# Sets the linger-on-close timeout. By default, this option is not set by the driver. The actual value will be the default from the underlying Netty transport
|
|
so_linger: "${CASSANDRA_SOCKET_SO_LINGER:}"
|
|
# Enable/Disable Nagle's algorithm
|
|
tcp_no_delay: "${CASSANDRA_SOCKET_TCP_NO_DELAY:false}"
|
|
# Sets a hint to the size of the underlying buffers for incoming network I/O. By default, this option is not set by the driver. The actual value will be the default from the underlying Netty transport
|
|
receive_buffer_size: "${CASSANDRA_SOCKET_RECEIVE_BUFFER_SIZE:}"
|
|
# Returns the hint to the size of the underlying buffers for outgoing network I/O. By default, this option is not set by the driver. The actual value will be the default from the underlying Netty transport
|
|
send_buffer_size: "${CASSANDRA_SOCKET_SEND_BUFFER_SIZE:}"
|
|
|
|
# Cassandra cluster connection query parameters
|
|
query:
|
|
# Consistency levels in Cassandra can be configured to manage availability versus data accuracy. The consistency level defaults to ONE for all write and read operations
|
|
read_consistency_level: "${CASSANDRA_READ_CONSISTENCY_LEVEL:ONE}"
|
|
# Consistency levels in Cassandra can be configured to manage availability versus data accuracy. The consistency level defaults to ONE for all write and read operations
|
|
write_consistency_level: "${CASSANDRA_WRITE_CONSISTENCY_LEVEL:ONE}"
|
|
# The fetch size specifies how many rows will be returned at once by Cassandra (in other words, it’s the size of each page)
|
|
default_fetch_size: "${CASSANDRA_DEFAULT_FETCH_SIZE:2000}"
|
|
# Specify partitioning size for timestamp key-value storage. Example: MINUTES, HOURS, DAYS, MONTHS, INDEFINITE
|
|
ts_key_value_partitioning: "${TS_KV_PARTITIONING:MONTHS}"
|
|
# Enable/Disable timestamp key-value partitioning on read queries
|
|
use_ts_key_value_partitioning_on_read: "${USE_TS_KV_PARTITIONING_ON_READ:true}"
|
|
# Safety trigger to fall back to use_ts_key_value_partitioning_on_read as true if estimated partitions count is greater than safety trigger value.
|
|
# It helps to prevent building huge partition list (OOM) for corner cases (like from 0 to infinity) and prefer fewer reads strategy from NoSQL database
|
|
use_ts_key_value_partitioning_on_read_max_estimated_partition_count: "${USE_TS_KV_PARTITIONING_ON_READ_MAX_ESTIMATED_PARTITION_COUNT:40}"
|
|
# The number of partitions that are cached in memory of each service. It is useful to decrease the load of re-inserting the same partitions again
|
|
ts_key_value_partitions_max_cache_size: "${TS_KV_PARTITIONS_MAX_CACHE_SIZE:100000}"
|
|
# Timeseries Time To Live (in seconds) for Cassandra Record. 0 - record has never expired
|
|
ts_key_value_ttl: "${TS_KV_TTL:0}"
|
|
# Maximum number of Cassandra queries that are waiting for execution
|
|
buffer_size: "${CASSANDRA_QUERY_BUFFER_SIZE:200000}"
|
|
# Maximum number of concurrent Cassandra queries
|
|
concurrent_limit: "${CASSANDRA_QUERY_CONCURRENT_LIMIT:1000}"
|
|
# Max time in milliseconds query waits for execution
|
|
permit_max_wait_time: "${PERMIT_MAX_WAIT_TIME:120000}"
|
|
# Amount of threads to dispatch cassandra queries
|
|
dispatcher_threads: "${CASSANDRA_QUERY_DISPATCHER_THREADS:2}"
|
|
callback_threads: "${CASSANDRA_QUERY_CALLBACK_THREADS:4}" # Buffered rate executor (read, write) for managing I/O rate. See "nosql-*-callback" threads in JMX
|
|
result_processing_threads: "${CASSANDRA_QUERY_RESULT_PROCESSING_THREADS:50}" # Result set transformer and processing. See "cassandra-callback" threads in JMX
|
|
# Cassandra query queue polling interval in milliseconds
|
|
poll_ms: "${CASSANDRA_QUERY_POLL_MS:50}"
|
|
# Interval in milliseconds for printing Cassandra query queue statistic
|
|
rate_limit_print_interval_ms: "${CASSANDRA_QUERY_RATE_LIMIT_PRINT_MS:10000}"
|
|
# When saving a value, set other data types to null (to avoid having multiple telemetry values with the same timestamp).
|
|
set_null_values_enabled: "${CASSANDRA_QUERY_SET_NULL_VALUES_ENABLED:true}"
|
|
# log one of cassandra queries with specified frequency (0 - logging is disabled)
|
|
print_queries_freq: "${CASSANDRA_QUERY_PRINT_FREQ:0}"
|
|
# Maximum total size in bytes of a Cassandra query result set across all pages. Default is 50MB. 0 means unlimited
|
|
max_result_set_size_in_bytes: "${CASSANDRA_QUERY_MAX_RESULT_SET_SIZE_IN_BYTES:52428800}"
|
|
tenant_rate_limits:
|
|
# Whether to print rate-limited tenant names when printing Cassandra query queue statistic
|
|
print_tenant_names: "${CASSANDRA_QUERY_TENANT_RATE_LIMITS_PRINT_TENANT_NAMES:false}"
|
|
|
|
# SQL configuration parameters
|
|
# Tunes batch sizes, delays, thread counts, TTL, and partitioning for SQL-backed persistence of telemetry, events, and audit logs.
|
|
sql:
|
|
# Specify batch size for persisting attribute updates
|
|
attributes:
|
|
batch_size: "${SQL_ATTRIBUTES_BATCH_SIZE:1000}" # Batch size for persisting attribute updates
|
|
batch_max_delay: "${SQL_ATTRIBUTES_BATCH_MAX_DELAY_MS:50}" # Max timeout for attributes entries queue polling. The value is set in milliseconds
|
|
stats_print_interval_ms: "${SQL_ATTRIBUTES_BATCH_STATS_PRINT_MS:10000}" # Interval in milliseconds for printing attributes updates statistic
|
|
batch_threads: "${SQL_ATTRIBUTES_BATCH_THREADS:3}" # batch thread count has to be a prime number like 3 or 5 to gain perfect hash distribution
|
|
value_no_xss_validation: "${SQL_ATTRIBUTES_VALUE_NO_XSS_VALIDATION:false}" # If true attribute values will be checked for XSS vulnerability
|
|
ts:
|
|
batch_size: "${SQL_TS_BATCH_SIZE:10000}" # Batch size for persisting timeseries inserts
|
|
batch_max_delay: "${SQL_TS_BATCH_MAX_DELAY_MS:100}" # Max timeout for time-series entries queue polling. The value set in milliseconds
|
|
stats_print_interval_ms: "${SQL_TS_BATCH_STATS_PRINT_MS:10000}" # Interval in milliseconds for printing timeseries insert statistic
|
|
batch_threads: "${SQL_TS_BATCH_THREADS:3}" # batch thread count has to be a prime number like 3 or 5 to gain perfect hash distribution
|
|
value_no_xss_validation: "${SQL_TS_VALUE_NO_XSS_VALIDATION:false}" # If true telemetry values will be checked for XSS vulnerability
|
|
callback_thread_pool_size: "${SQL_TS_CALLBACK_THREAD_POOL_SIZE:12}" # Thread pool size for telemetry callback executor
|
|
ts_latest:
|
|
batch_size: "${SQL_TS_LATEST_BATCH_SIZE:1000}" # Batch size for persisting latest telemetry updates
|
|
batch_max_delay: "${SQL_TS_LATEST_BATCH_MAX_DELAY_MS:50}" # Maximum timeout for latest telemetry entries queue polling. The value set in milliseconds
|
|
stats_print_interval_ms: "${SQL_TS_LATEST_BATCH_STATS_PRINT_MS:10000}" # Interval in milliseconds for printing latest telemetry updates statistic
|
|
batch_threads: "${SQL_TS_LATEST_BATCH_THREADS:3}" # batch thread count has to be a prime number like 3 or 5 to gain perfect hash distribution
|
|
update_by_latest_ts: "${SQL_TS_UPDATE_BY_LATEST_TIMESTAMP:true}" # Update latest values only if the timestamp of the new record is greater or equals the timestamp of the previously saved latest value. The latest values are stored separately from historical values for fast lookup from DB. Insert of historical value happens in any case
|
|
events:
|
|
batch_size: "${SQL_EVENTS_BATCH_SIZE:10000}" # Batch size for persisting latest telemetry updates
|
|
batch_max_delay: "${SQL_EVENTS_BATCH_MAX_DELAY_MS:100}" # Max timeout for latest telemetry entries queue polling. The value set in milliseconds
|
|
stats_print_interval_ms: "${SQL_EVENTS_BATCH_STATS_PRINT_MS:10000}" # Interval in milliseconds for printing latest telemetry updates statistic
|
|
batch_threads: "${SQL_EVENTS_BATCH_THREADS:3}" # batch thread count has to be a prime number like 3 or 5 to gain perfect hash distribution
|
|
partition_size: "${SQL_EVENTS_REGULAR_PARTITION_SIZE_HOURS:168}" # Number of hours to partition the events. The current value corresponds to one week.
|
|
debug_partition_size: "${SQL_EVENTS_DEBUG_PARTITION_SIZE_HOURS:1}" # Number of hours to partition the debug events. The current value corresponds to one hour.
|
|
edge_events:
|
|
batch_size: "${SQL_EDGE_EVENTS_BATCH_SIZE:1000}" # Batch size for persisting latest telemetry updates
|
|
batch_max_delay: "${SQL_EDGE_EVENTS_BATCH_MAX_DELAY_MS:100}" # Max timeout for latest telemetry entries queue polling. The value set in milliseconds
|
|
stats_print_interval_ms: "${SQL_EDGE_EVENTS_BATCH_STATS_PRINT_MS:10000}" # Interval in milliseconds for printing latest telemetry updates statistic
|
|
partition_size: "${SQL_EDGE_EVENTS_PARTITION_SIZE_HOURS:168}" # Number of hours to partition the events. The current value corresponds to one week.
|
|
audit_logs:
|
|
partition_size: "${SQL_AUDIT_LOGS_PARTITION_SIZE_HOURS:168}" # Default value - 1 week
|
|
alarm_comments:
|
|
partition_size: "${SQL_ALARM_COMMENTS_PARTITION_SIZE_HOURS:168}" # Default value - 1 week
|
|
notifications:
|
|
partition_size: "${SQL_NOTIFICATIONS_PARTITION_SIZE_HOURS:168}" # Default value - 1 week
|
|
# Specify whether to sort entities before batch update. Should be enabled for cluster mode to avoid deadlocks
|
|
batch_sort: "${SQL_BATCH_SORT:true}"
|
|
# Specify whether to remove null characters from strValue of attributes and timeseries before insert
|
|
remove_null_chars: "${SQL_REMOVE_NULL_CHARS:true}"
|
|
# Specify whether to log database queries and their parameters generated by the entity query repository
|
|
log_queries: "${SQL_LOG_QUERIES:false}"
|
|
# Threshold of slow SQL queries to log. The value set in milliseconds
|
|
log_queries_threshold: "${SQL_LOG_QUERIES_THRESHOLD:5000}"
|
|
# Enable/Disable logging statistic information about tenants
|
|
log_tenant_stats: "${SQL_LOG_TENANT_STATS:true}"
|
|
# Interval in milliseconds for printing the latest statistic information about the tenant
|
|
log_tenant_stats_interval_ms: "${SQL_LOG_TENANT_STATS_INTERVAL_MS:60000}"
|
|
postgres:
|
|
# Specify partitioning size for timestamp key-value storage. Example: DAYS, MONTHS, YEARS, INDEFINITE.
|
|
ts_key_value_partitioning: "${SQL_POSTGRES_TS_KV_PARTITIONING:MONTHS}"
|
|
timescale:
|
|
# Specify Interval size for new data chunks storage.
|
|
chunk_time_interval: "${SQL_TIMESCALE_CHUNK_TIME_INTERVAL:604800000}"
|
|
batch_threads: "${SQL_TIMESCALE_BATCH_THREADS:3}" # batch thread count has to be a prime number like 3 or 5 to gain perfect hash distribution
|
|
ttl:
|
|
ts:
|
|
# Enable/disable TTL (Time To Live) for timeseries records
|
|
enabled: "${SQL_TTL_TS_ENABLED:true}"
|
|
execution_interval_ms: "${SQL_TTL_TS_EXECUTION_INTERVAL:86400000}" # Number of milliseconds. The current value corresponds to one day
|
|
# The parameter to specify system TTL(Time To Live) value for timeseries records. Value set in seconds.
|
|
# 0 - records are never expired.
|
|
ts_key_value_ttl: "${SQL_TTL_TS_TS_KEY_VALUE_TTL:0}"
|
|
events:
|
|
# Enable/disable TTL (Time To Live) for event records
|
|
enabled: "${SQL_TTL_EVENTS_ENABLED:true}"
|
|
execution_interval_ms: "${SQL_TTL_EVENTS_EXECUTION_INTERVAL:3600000}" # Number of milliseconds (max random initial delay and fixed period).
|
|
# Number of seconds. TTL is disabled by default. The accuracy of the cleanup depends on the sql.events.partition_size parameter.
|
|
events_ttl: "${SQL_TTL_EVENTS_EVENTS_TTL:0}"
|
|
# Number of seconds. The current value corresponds to one week. The accuracy of the cleanup depends on the sql.events.debug_partition_size parameter.
|
|
debug_events_ttl: "${SQL_TTL_EVENTS_DEBUG_EVENTS_TTL:604800}"
|
|
edge_events:
|
|
enabled: "${SQL_TTL_EDGE_EVENTS_ENABLED:true}" # Enable/disable TTL (Time To Live) for edge event records
|
|
execution_interval_ms: "${SQL_TTL_EDGE_EVENTS_EXECUTION_INTERVAL:86400000}" # Number of milliseconds. The current value corresponds to one day
|
|
edge_events_ttl: "${SQL_TTL_EDGE_EVENTS_TTL:2628000}" # Number of seconds. The current value corresponds to one month
|
|
alarms:
|
|
checking_interval: "${SQL_ALARMS_TTL_CHECKING_INTERVAL:7200000}" # Number of milliseconds. The current value corresponds to two hours
|
|
removal_batch_size: "${SQL_ALARMS_TTL_REMOVAL_BATCH_SIZE:3000}" # Batch size for records removal
|
|
rpc:
|
|
enabled: "${SQL_TTL_RPC_ENABLED:true}" # Enable/disable TTL (Time To Live) for rpc call records
|
|
checking_interval: "${SQL_RPC_TTL_CHECKING_INTERVAL:7200000}" # Number of milliseconds. The current value corresponds to two hours
|
|
removal_batch_size: "${SQL_RPC_TTL_REMOVAL_BATCH_SIZE:10000}" # Batch size for records removal
|
|
audit_logs:
|
|
enabled: "${SQL_TTL_AUDIT_LOGS_ENABLED:true}" # Enable/disable TTL (Time To Live) for audit log records
|
|
ttl: "${SQL_TTL_AUDIT_LOGS_SECS:0}" # Disabled by default. The accuracy of the cleanup depends on the sql.audit_logs.partition_size
|
|
checking_interval_ms: "${SQL_TTL_AUDIT_LOGS_CHECKING_INTERVAL_MS:86400000}" # Default value - 1 day
|
|
notifications:
|
|
enabled: "${SQL_TTL_NOTIFICATIONS_ENABLED:true}" # Enable/disable TTL (Time To Live) for notification center records
|
|
ttl: "${SQL_TTL_NOTIFICATIONS_SECS:2592000}" # Default value - 30 days
|
|
checking_interval_ms: "${SQL_TTL_NOTIFICATIONS_CHECKING_INTERVAL_MS:86400000}" # Default value - 1 day
|
|
removal_batch_size: "${SQL_TTL_NOTIFICATIONS_REMOVAL_BATCH_SIZE:10000}" # Batch size for records removal
|
|
api_keys:
|
|
enabled: "${SQL_TTL_API_KEYS_ENABLED:true}" # Enable/disable TTL (Time To Live) for expired api keys records
|
|
checking_interval_ms: "${SQL_TTL_API_KEYS_CHECKING_INTERVAL_MS:86400000}" # Default value - 1 day
|
|
relations:
|
|
max_level: "${SQL_RELATIONS_MAX_LEVEL:50}" # This value has to be reasonably small to prevent infinite recursion as early as possible
|
|
pool_size: "${SQL_RELATIONS_POOL_SIZE:4}" # This value has to be reasonably small to prevent the relation query from blocking all other DB calls
|
|
query_timeout: "${SQL_RELATIONS_QUERY_TIMEOUT_SEC:20}" # This value has to be reasonably small to prevent the relation query from blocking all other DB calls
|
|
|
|
# Actor system parameters
|
|
# Configures thread pools, timeouts, and behavior for the internal actor system processing devices, rules, and RPCs.
|
|
actors:
|
|
system:
|
|
throughput: "${ACTORS_SYSTEM_THROUGHPUT:5}" # Number of messages the actor system will process per actor before switching to processing of messages for the next actor
|
|
scheduler_pool_size: "${ACTORS_SYSTEM_SCHEDULER_POOL_SIZE:1}" # Thread pool size for actor system scheduler
|
|
max_actor_init_attempts: "${ACTORS_SYSTEM_MAX_ACTOR_INIT_ATTEMPTS:10}" # Maximum number of attempts to init the actor before disabling the actor
|
|
app_dispatcher_pool_size: "${ACTORS_SYSTEM_APP_DISPATCHER_POOL_SIZE:1}" # Thread pool size for main actor system dispatcher
|
|
tenant_dispatcher_pool_size: "${ACTORS_SYSTEM_TENANT_DISPATCHER_POOL_SIZE:2}" # Thread pool size for actor system dispatcher that process messages for tenant actors
|
|
device_dispatcher_pool_size: "${ACTORS_SYSTEM_DEVICE_DISPATCHER_POOL_SIZE:4}" # Thread pool size for actor system dispatcher that process messages for device actors
|
|
rule_dispatcher_pool_size: "${ACTORS_SYSTEM_RULE_DISPATCHER_POOL_SIZE:8}" # Thread pool size for actor system dispatcher that process messages for rule engine (chain/node) actors
|
|
edge_dispatcher_pool_size: "${ACTORS_SYSTEM_EDGE_DISPATCHER_POOL_SIZE:4}" # Thread pool size for actor system dispatcher that process messages for edge actors
|
|
cfm_dispatcher_pool_size: "${ACTORS_SYSTEM_CFM_DISPATCHER_POOL_SIZE:2}" # Thread pool size for actor system dispatcher that process messages for CalculatedField manager actors
|
|
cfe_dispatcher_pool_size: "${ACTORS_SYSTEM_CFE_DISPATCHER_POOL_SIZE:8}" # Thread pool size for actor system dispatcher that process messages for CalculatedField entity actors
|
|
tenant:
|
|
create_components_on_init: "${ACTORS_TENANT_CREATE_COMPONENTS_ON_INIT:true}" # Create components in initialization
|
|
session:
|
|
max_concurrent_sessions_per_device: "${ACTORS_MAX_CONCURRENT_SESSION_PER_DEVICE:1}" # Max number of concurrent sessions per device
|
|
sync:
|
|
# Default timeout for processing requests using synchronous session (HTTP, CoAP) in milliseconds
|
|
timeout: "${ACTORS_SESSION_SYNC_TIMEOUT:10000}"
|
|
rule:
|
|
# Specify thread pool size for database request callbacks executor service
|
|
db_callback_thread_pool_size: "${ACTORS_RULE_DB_CALLBACK_THREAD_POOL_SIZE:50}"
|
|
# Specify thread pool size for mail sender executor service
|
|
mail_thread_pool_size: "${ACTORS_RULE_MAIL_THREAD_POOL_SIZE:40}"
|
|
# Specify thread pool size for password reset emails
|
|
mail_password_reset_thread_pool_size: "${ACTORS_RULE_MAIL_PASSWORD_RESET_THREAD_POOL_SIZE:10}"
|
|
# Specify thread pool size for sms sender executor service
|
|
sms_thread_pool_size: "${ACTORS_RULE_SMS_THREAD_POOL_SIZE:50}"
|
|
# Whether to allow usage of system mail service for rules
|
|
allow_system_mail_service: "${ACTORS_RULE_ALLOW_SYSTEM_MAIL_SERVICE:true}"
|
|
# Whether to allow usage of system sms service for rules
|
|
allow_system_sms_service: "${ACTORS_RULE_ALLOW_SYSTEM_SMS_SERVICE:true}"
|
|
# Specify thread pool size for external call service
|
|
external_call_thread_pool_size: "${ACTORS_RULE_EXTERNAL_CALL_THREAD_POOL_SIZE:50}"
|
|
# Configuration for the thread pool that executes HTTP calls to AI provider APIs
|
|
ai-requests-thread-pool:
|
|
# The base name for threads
|
|
pool-name: "${ACTORS_RULE_AI_REQUESTS_THREAD_POOL_NAME:ai-requests}"
|
|
# The maximum number of concurrent HTTP requests
|
|
pool-size: "${ACTORS_RULE_AI_REQUESTS_THREAD_POOL_SIZE:50}"
|
|
# The maximum time in seconds to wait for active tasks to complete during graceful shutdown
|
|
termination-timeout-seconds: "${ACTORS_RULE_AI_REQUESTS_THREAD_POOL_TERMINATION_TIMEOUT_SECONDS:60}"
|
|
chain:
|
|
# Errors for particular actors are persisted once per specified amount of milliseconds
|
|
error_persist_frequency: "${ACTORS_RULE_CHAIN_ERROR_FREQUENCY:3000}"
|
|
debug_mode_rate_limits_per_tenant:
|
|
# Enable/Disable the rate limit of persisted debug events for all rule nodes per tenant
|
|
enabled: "${ACTORS_RULE_CHAIN_DEBUG_MODE_RATE_LIMITS_PER_TENANT_ENABLED:true}"
|
|
# The value of DEBUG mode rate limit. By default, no more than 50 thousand events per hour
|
|
configuration: "${ACTORS_RULE_CHAIN_DEBUG_MODE_RATE_LIMITS_PER_TENANT_CONFIGURATION:50000:3600}"
|
|
node:
|
|
# Errors for particular actor are persisted once per specified amount of milliseconds
|
|
error_persist_frequency: "${ACTORS_RULE_NODE_ERROR_FREQUENCY:3000}"
|
|
transaction:
|
|
# Size of queues that store messages for transaction rule nodes
|
|
queue_size: "${ACTORS_RULE_TRANSACTION_QUEUE_SIZE:15000}"
|
|
# Time in milliseconds for transaction to complete
|
|
duration: "${ACTORS_RULE_TRANSACTION_DURATION:60000}"
|
|
external:
|
|
# Force acknowledgment of the incoming message for external rule nodes to decrease processing latency.
|
|
# Enqueue the result of external node processing as a separate message to the rule engine.
|
|
force_ack: "${ACTORS_RULE_EXTERNAL_NODE_FORCE_ACK:false}"
|
|
# Enable Server-Side Request Forgery (SSRF) protection for external HTTP rule nodes (rest api call).
|
|
# When enabled, requests to private/internal network addresses are blocked.
|
|
ssrf_protection_enabled: "${SSRF_PROTECTION_ENABLED:false}"
|
|
# Comma-separated list of additional blocked destinations (IPs, CIDR subnets, or hostnames).
|
|
# Example: "198.51.100.0/24,metadata.tencentyun.com,rancher-metadata"
|
|
ssrf_additional_blocked_hosts: "${SSRF_ADDITIONAL_BLOCKED_HOSTS:}"
|
|
# Comma-separated list of allowed destinations that bypass SSRF blocking (IPs, CIDR subnets, or hostnames).
|
|
# Use this when your rule chains need to reach devices on private networks (e.g., 192.168.1.0/24).
|
|
# Example: "192.168.1.0/24,10.0.0.0/8,my-internal-service.corp"
|
|
ssrf_allowed_hosts: "${SSRF_ALLOWED_HOSTS:}"
|
|
rpc:
|
|
# Maximum number of persistent RPC call retries in case of failed request delivery.
|
|
max_retries: "${ACTORS_RPC_MAX_RETRIES:5}"
|
|
# RPC submit strategies. Allowed values: BURST, SEQUENTIAL_ON_ACK_FROM_DEVICE, SEQUENTIAL_ON_RESPONSE_FROM_DEVICE.
|
|
submit_strategy: "${ACTORS_RPC_SUBMIT_STRATEGY_TYPE:BURST}"
|
|
# Time in milliseconds for RPC to receive a response after delivery. Used only for SEQUENTIAL_ON_RESPONSE_FROM_DEVICE submit strategy.
|
|
response_timeout_ms: "${ACTORS_RPC_RESPONSE_TIMEOUT_MS:30000}"
|
|
# Close transport session if RPC delivery timed out. If enabled, RPC will be reverted to the queued state.
|
|
# Note:
|
|
# <ul><li> For MQTT transport:
|
|
# <ul><li> QoS level 0: This feature does not apply, as no acknowledgment is expected, and therefore no timeout is triggered.</li>
|
|
# <li> QoS level 1: This feature applies, as an acknowledgment is expected.</li>
|
|
# <li> QoS level 2: Unsupported.</li></ul></li>
|
|
# <li> For CoAP transport:
|
|
# <ul><li> Confirmable requests: This feature applies, as delivery confirmation is expected.</li>
|
|
# <li> Non-confirmable requests: This feature does not apply, as no delivery acknowledgment is expected.</li></ul></li>
|
|
# <li> For HTTP and SNPM transports: RPC is considered delivered immediately, and there is no logic to await acknowledgment.</li></ul>
|
|
close_session_on_rpc_delivery_timeout: "${ACTORS_RPC_CLOSE_SESSION_ON_RPC_DELIVERY_TIMEOUT:false}"
|
|
statistics:
|
|
# Enable/disable actor statistics
|
|
enabled: "${ACTORS_STATISTICS_ENABLED:true}"
|
|
# Actors statistic persistence frequency in milliseconds
|
|
persist_frequency: "${ACTORS_STATISTICS_PERSIST_FREQUENCY:3600000}"
|
|
calculated_fields:
|
|
debug_mode_rate_limits_per_tenant:
|
|
# Enable/Disable the rate limit of persisted debug events for all calculated fields per tenant
|
|
enabled: "${ACTORS_CALCULATED_FIELD_DEBUG_MODE_RATE_LIMITS_PER_TENANT_ENABLED:true}"
|
|
# The value of DEBUG mode rate limit. By default, no more than 50 thousand events per hour
|
|
configuration: "${ACTORS_CALCULATED_FIELD_DEBUG_MODE_RATE_LIMITS_PER_TENANT_CONFIGURATION:50000:3600}"
|
|
# Time in seconds to receive calculation result.
|
|
calculation_timeout: "${ACTORS_CALCULATION_TIMEOUT_SEC:5}"
|
|
|
|
# Debug settings parameters
|
|
# Configures the global default duration for debug mode used by rule chains and calculated fields.
|
|
debug:
|
|
settings:
|
|
# Default duration (in minutes) for debug mode. Min value is 1 minute. Tenant profile settings override this one.
|
|
# If value from this setting is invalid, the default value (15 minutes) will be used.
|
|
default_duration: "${DEBUG_SETTINGS_DEFAULT_DURATION_MINUTES:15}"
|
|
|
|
# Cache settings parameters
|
|
# Configures cache type (Caffeine or Redis), pool size, and per-entity TTL and max-size limits for all caches.
|
|
cache:
|
|
# caffeine or redis(7.2 - latest compatible version)
|
|
type: "${CACHE_TYPE:caffeine}"
|
|
maximumPoolSize: "${CACHE_MAXIMUM_POOL_SIZE:16}" # max pool size to process futures that call the external cache
|
|
attributes:
|
|
# make sure that if cache.type is 'redis' and cache.attributes.enabled is 'true' if you change 'maxmemory-policy' Redis config property to 'allkeys-lru', 'allkeys-lfu' or 'allkeys-random'
|
|
enabled: "${CACHE_ATTRIBUTES_ENABLED:true}"
|
|
ts_latest:
|
|
# Will enable cache-aside strategy for SQL timeseries latest DAO.
|
|
# make sure that if cache.type is 'redis' and cache.ts_latest.enabled is 'true' if you change 'maxmemory-policy' Redis config property to 'allkeys-lru', 'allkeys-lfu' or 'allkeys-random'
|
|
enabled: "${CACHE_TS_LATEST_ENABLED:true}"
|
|
specs:
|
|
relations:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_RELATIONS_TTL:1440}" # Relations cache TTL
|
|
maxSize: "${CACHE_SPECS_RELATIONS_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
deviceCredentials:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_DEVICE_CREDENTIALS_TTL:1440}" # Device credentials cache TTL
|
|
maxSize: "${CACHE_SPECS_DEVICE_CREDENTIALS_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
devices:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_DEVICES_TTL:1440}" # Device cache TTL
|
|
maxSize: "${CACHE_SPECS_DEVICES_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
sessions:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_SESSIONS_TTL:1440}" # Sessions cache TTL
|
|
maxSize: "${CACHE_SPECS_SESSIONS_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
assets:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_ASSETS_TTL:1440}" # Asset cache TTL
|
|
maxSize: "${CACHE_SPECS_ASSETS_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
customers:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_CUSTOMERS_TTL:1440}" # Customer cache TTL
|
|
maxSize: "${CACHE_SPECS_CUSTOMERS_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
users:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_USERS_TTL:1440}" # User cache TTL
|
|
maxSize: "${CACHE_SPECS_USERS_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
entityViews:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_ENTITY_VIEWS_TTL:1440}" # Entity view cache TTL
|
|
maxSize: "${CACHE_SPECS_ENTITY_VIEWS_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
claimDevices:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_CLAIM_DEVICES_TTL:1440}" # Claim devices cache TTL
|
|
maxSize: "${CACHE_SPECS_CLAIM_DEVICES_MAX_SIZE:1000}" # 0 means the cache is disabled
|
|
securitySettings:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_SECURITY_SETTINGS_TTL:1440}" # Security settings cache TTL
|
|
maxSize: "${CACHE_SPECS_SECURITY_SETTINGS_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
tenantProfiles:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_TENANT_PROFILES_TTL:1440}" # Tenant profiles cache TTL
|
|
maxSize: "${CACHE_SPECS_TENANT_PROFILES_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
tenants:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_TENANTS_TTL:1440}" # Tenant cache TTL
|
|
maxSize: "${CACHE_SPECS_TENANTS_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
tenantsExist:
|
|
# Environment variables are intentionally the same as in 'tenants' cache to be equal.
|
|
timeToLiveInMinutes: "${CACHE_SPECS_TENANTS_TTL:1440}"
|
|
maxSize: "${CACHE_SPECS_TENANTS_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
deviceProfiles:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_DEVICE_PROFILES_TTL:1440}" # Device profile cache TTL
|
|
maxSize: "${CACHE_SPECS_DEVICE_PROFILES_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
assetProfiles:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_ASSET_PROFILES_TTL:1440}" # Asset profile cache TTL
|
|
maxSize: "${CACHE_SPECS_ASSET_PROFILES_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
notificationSettings:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_NOTIFICATION_SETTINGS_TTL:10}" # Notification settings cache TTL
|
|
maxSize: "${CACHE_SPECS_NOTIFICATION_SETTINGS_MAX_SIZE:1000}" # 0 means the cache is disabled
|
|
sentNotifications:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_SENT_NOTIFICATIONS_TTL:1440}" # Sent notifications cache TTL
|
|
maxSize: "${CACHE_SPECS_SENT_NOTIFICATIONS_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
attributes:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_ATTRIBUTES_TTL:1440}" # Attributes cache TTL
|
|
maxSize: "${CACHE_SPECS_ATTRIBUTES_MAX_SIZE:100000}" # 0 means the cache is disabled
|
|
tsLatest:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_TS_LATEST_TTL:1440}" # Timeseries latest cache TTL
|
|
maxSize: "${CACHE_SPECS_TS_LATEST_MAX_SIZE:100000}" # 0 means the cache is disabled
|
|
userSessionsInvalidation:
|
|
# The value of this TTL is ignored and replaced by the JWT refresh token expiration time
|
|
timeToLiveInMinutes: "0"
|
|
maxSize: "${CACHE_SPECS_USERS_UPDATE_TIME_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
otaPackages:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_OTA_PACKAGES_TTL:60}" # Ota packages cache TTL
|
|
maxSize: "${CACHE_SPECS_OTA_PACKAGES_MAX_SIZE:10}" # 0 means the cache is disabled
|
|
otaPackagesData:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_OTA_PACKAGES_DATA_TTL:60}" # Ota packages data cache TTL
|
|
maxSize: "${CACHE_SPECS_OTA_PACKAGES_DATA_MAX_SIZE:10}" # 0 means the cache is disabled
|
|
edges:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_EDGES_TTL:1440}" # Edges cache TTL
|
|
maxSize: "${CACHE_SPECS_EDGES_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
edgeSessions:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_EDGE_SESSIONS_TTL:0}" # Edge Sessions cache TTL; no expiration time if set to '0'
|
|
maxSize: "${CACHE_SPECS_EDGE_SESSIONS_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
relatedEdges:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_RELATED_EDGES_TTL:1440}" # Related Edges cache TTL
|
|
maxSize: "${CACHE_SPECS_RELATED_EDGES_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
repositorySettings:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_REPOSITORY_SETTINGS_TTL:1440}" # Repository settings cache TTL
|
|
maxSize: "${CACHE_SPECS_REPOSITORY_SETTINGS_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
autoCommitSettings:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_AUTO_COMMIT_SETTINGS_TTL:1440}" # Autocommit settings cache TTL
|
|
maxSize: "${CACHE_SPECS_AUTO_COMMIT_SETTINGS_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
twoFaVerificationCodes:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_TWO_FA_VERIFICATION_CODES_TTL:60}" # Two factor verification codes cache TTL
|
|
maxSize: "${CACHE_SPECS_TWO_FA_VERIFICATION_CODES_MAX_SIZE:100000}" # 0 means the cache is disabled
|
|
versionControlTask:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_VERSION_CONTROL_TASK_TTL:20}" # Version control task cache TTL
|
|
maxSize: "${CACHE_SPECS_VERSION_CONTROL_TASK_MAX_SIZE:100000}" # 0 means the cache is disabled
|
|
userSettings:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_USER_SETTINGS_TTL:1440}" # User settings cache TTL
|
|
maxSize: "${CACHE_SPECS_USER_SETTINGS_MAX_SIZE:100000}" # 0 means the cache is disabled
|
|
dashboardTitles:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_DASHBOARD_TITLES_TTL:1440}" # Dashboard titles cache TTL
|
|
maxSize: "${CACHE_SPECS_DASHBOARD_TITLES_MAX_SIZE:100000}" # 0 means the cache is disabled
|
|
entityCount:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_ENTITY_COUNT_TTL:1440}" # Entity count cache TTL
|
|
maxSize: "${CACHE_SPECS_ENTITY_COUNT_MAX_SIZE:100000}" # 0 means the cache is disabled
|
|
resourceInfo:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_RESOURCE_INFO_TTL:1440}" # Resource info cache TTL
|
|
maxSize: "${CACHE_SPECS_RESOURCE_INFO_MAX_SIZE:100000}" # 0 means the cache is disabled
|
|
alarmTypes:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_ALARM_TYPES_TTL:60}" # Alarm types cache TTL
|
|
maxSize: "${CACHE_SPECS_ALARM_TYPES_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
qrCodeSettings:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_MOBILE_APP_SETTINGS_TTL:1440}" # Qr code settings cache TTL
|
|
maxSize: "${CACHE_SPECS_MOBILE_APP_SETTINGS_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
mobileSecretKey:
|
|
timeToLiveInMinutes: "${CACHE_MOBILE_SECRET_KEY_TTL:2}" # QR secret key cache TTL
|
|
maxSize: "${CACHE_MOBILE_SECRET_KEY_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
trendzSettings:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_TRENDZ_SETTINGS_TTL:1440}" # Trendz settings cache TTL
|
|
maxSize: "${CACHE_SPECS_TRENDZ_SETTINGS_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
aiModel:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_AI_MODEL_TTL:1440}" # AI model cache TTL
|
|
maxSize: "${CACHE_SPECS_AI_MODEL_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
apiKeys:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_API_KEYS_TTL:1440}" # API keys cache TTL
|
|
maxSize: "${CACHE_SPECS_API_KEYS_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
|
|
# Deliberately placed outside the 'specs' group above
|
|
notificationRules:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_NOTIFICATION_RULES_TTL:30}" # Notification rules cache TTL
|
|
maxSize: "${CACHE_SPECS_NOTIFICATION_RULES_MAX_SIZE:1000}" # 0 means the cache is disabled
|
|
rateLimits:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_RATE_LIMITS_TTL:120}" # Rate limits cache TTL
|
|
maxSize: "${CACHE_SPECS_RATE_LIMITS_MAX_SIZE:200000}" # 0 means the cache is disabled
|
|
entityLimits:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_ENTITY_LIMITS_TTL:5}" # Entity limits cache TTL
|
|
maxSize: "${CACHE_SPECS_ENTITY_LIMITS_MAX_SIZE:100000}" # 0 means the cache is disabled
|
|
image:
|
|
etag:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_IMAGE_ETAGS_TTL:44640}" # Image ETags cache TTL
|
|
maxSize: "${CACHE_SPECS_IMAGE_ETAGS_MAX_SIZE:10000}" # 0 means the cache is disabled
|
|
systemImagesBrowserTtlInMinutes: "${CACHE_SPECS_IMAGE_SYSTEM_BROWSER_TTL:0}" # Browser cache TTL for system images in minutes. 0 means the cache is disabled
|
|
tenantImagesBrowserTtlInMinutes: "${CACHE_SPECS_IMAGE_TENANT_BROWSER_TTL:0}" # Browser cache TTL for tenant images in minutes. 0 means the cache is disabled
|
|
tbResourceData:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_RESOURCE_DATA_TTL:10080}" # TB resource data cache TTL
|
|
maxSize: "${CACHE_SPECS_RESOURCE_DATA_MAX_SIZE:100000}" # 0 means the cache is disabled
|
|
userAuthDetails:
|
|
timeToLiveInMinutes: "${CACHE_SPECS_USER_AUTH_DETAILS_TTL:120}" # User auth details cache TTL
|
|
maxSize: "${CACHE_SPECS_USER_AUTH_DETAILS_MAX_SIZE:200000}" # 0 means the cache is disabled
|
|
|
|
# Spring data parameters
|
|
spring.data.redis.repositories.enabled: false # Disable this because it is not required.
|
|
|
|
# Redis/Valkey configuration parameters
|
|
# Configures standalone, cluster, or sentinel Redis connection, SSL, and connection pool settings used for caching.
|
|
redis:
|
|
# standalone or cluster or sentinel
|
|
connection:
|
|
# Redis deployment type: Standalone (single Redis node deployment) OR Cluster
|
|
type: "${REDIS_CONNECTION_TYPE:standalone}"
|
|
standalone:
|
|
# Redis connection host
|
|
host: "${REDIS_HOST:localhost}"
|
|
# Redis connection port
|
|
port: "${REDIS_PORT:6379}"
|
|
# Use the default Redis configuration file
|
|
useDefaultClientConfig: "${REDIS_USE_DEFAULT_CLIENT_CONFIG:true}"
|
|
# This value may be used only if you used not default ClientConfig
|
|
clientName: "${REDIS_CLIENT_NAME:standalone}"
|
|
# This value may be used only if you used not default ClientConfig
|
|
connectTimeout: "${REDIS_CLIENT_CONNECT_TIMEOUT:30000}"
|
|
# This value may be used only if you used not default ClientConfig
|
|
readTimeout: "${REDIS_CLIENT_READ_TIMEOUT:60000}"
|
|
# This value may be used only if you used not default ClientConfig
|
|
usePoolConfig: "${REDIS_CLIENT_USE_POOL_CONFIG:false}"
|
|
cluster:
|
|
# Comma-separated list of "host:port" pairs to bootstrap from.
|
|
nodes: "${REDIS_NODES:}"
|
|
# Maximum number of redirects to follow when executing commands across the cluster.
|
|
max-redirects: "${REDIS_MAX_REDIRECTS:12}"
|
|
# if set false will be used pool config build from values of the pool config section
|
|
useDefaultPoolConfig: "${REDIS_USE_DEFAULT_POOL_CONFIG:true}"
|
|
sentinel:
|
|
# Name of the master node
|
|
master: "${REDIS_MASTER:}"
|
|
# Comma-separated list of "host:port" pairs of sentinels
|
|
sentinels: "${REDIS_SENTINELS:}"
|
|
# Password to authenticate with sentinel
|
|
password: "${REDIS_SENTINEL_PASSWORD:}"
|
|
# If set false will be used pool config build from values of the pool config section
|
|
useDefaultPoolConfig: "${REDIS_USE_DEFAULT_POOL_CONFIG:true}"
|
|
# Redis logical database index to select after connecting.
|
|
db: "${REDIS_DB:0}"
|
|
# Password for Redis authentication (leave empty if not required).
|
|
password: "${REDIS_PASSWORD:}"
|
|
# Redis username for ACL authentication (Redis 6.0+). Leave empty for legacy password-only auth
|
|
username: "${REDIS_USERNAME:}"
|
|
# ssl config
|
|
ssl:
|
|
# Enable/disable secure connection
|
|
enabled: "${TB_REDIS_SSL_ENABLED:false}"
|
|
# Server SSL credentials (only PEM format is supported)
|
|
credentials:
|
|
# Path redis server (CA) certificate
|
|
cert_file: "${TB_REDIS_SSL_PEM_CERT:}"
|
|
# Path to user certificate file. This is optional for the client and can be used for two-way authentication for the client
|
|
user_cert_file: "${TB_REDIS_SSL_PEM_KEY:}"
|
|
# Path to user private key file. This is optional for the client and only needed if ‘user_cert_file’ is configured.
|
|
user_key_file: "${TB_REDIS_SSL_PEM_KEY_PASSWORD:}"
|
|
# pool config
|
|
pool_config:
|
|
# Maximum number of connections that can be allocated by the connection pool
|
|
maxTotal: "${REDIS_POOL_CONFIG_MAX_TOTAL:128}"
|
|
# Maximum number of idle connections that can be maintained in the pool without being closed
|
|
maxIdle: "${REDIS_POOL_CONFIG_MAX_IDLE:128}"
|
|
# Minumum number of idle connections that can be maintained in the pool without being closed
|
|
minIdle: "${REDIS_POOL_CONFIG_MIN_IDLE:16}"
|
|
# Enable/Disable PING command sent when a connection is borrowed
|
|
testOnBorrow: "${REDIS_POOL_CONFIG_TEST_ON_BORROW:false}"
|
|
# The property is used to specify whether to test the connection before returning it to the connection pool.
|
|
testOnReturn: "${REDIS_POOL_CONFIG_TEST_ON_RETURN:false}"
|
|
# The property is used in the context of connection pooling in Redis
|
|
testWhileIdle: "${REDIS_POOL_CONFIG_TEST_WHILE_IDLE:true}"
|
|
# Minimum time that an idle connection should be idle before it can be evicted from the connection pool. The value is set in milliseconds
|
|
minEvictableMs: "${REDIS_POOL_CONFIG_MIN_EVICTABLE_MS:60000}"
|
|
# Specifies the time interval in milliseconds between two consecutive eviction runs
|
|
evictionRunsMs: "${REDIS_POOL_CONFIG_EVICTION_RUNS_MS:30000}"
|
|
# Maximum time in milliseconds where a client is willing to wait for a connection from the pool when all connections are exhausted
|
|
maxWaitMills: "${REDIS_POOL_CONFIG_MAX_WAIT_MS:60000}"
|
|
# Specifies the number of connections to test for eviction during each eviction run
|
|
numberTestsPerEvictionRun: "${REDIS_POOL_CONFIG_NUMBER_TESTS_PER_EVICTION_RUN:3}"
|
|
# Determines the behavior when a thread requests a connection from the pool, but there are no available connections, and the pool cannot create more due to the maxTotal configuration
|
|
blockWhenExhausted: "${REDIS_POOL_CONFIG_BLOCK_WHEN_EXHAUSTED:true}"
|
|
# TTL for short-living SET commands that are used to replace DEL to enable transaction support
|
|
evictTtlInMs: "${REDIS_EVICT_TTL_MS:60000}"
|
|
|
|
|
|
# Update version parameters
|
|
# Controls whether the platform periodically checks for new ThingsBoard releases.
|
|
updates:
|
|
# Enable/disable checks for the new version
|
|
enabled: "${UPDATES_ENABLED:true}"
|
|
|
|
# Spring CORS configuration parameters.
|
|
# Controls the Access-Control-Allow-Origin and Access-Control-Allow-Credentials response headers.
|
|
# WARNING: The default configuration allows cross-origin requests from ANY domain with credentials.
|
|
# This means any website can make API requests on behalf of an authenticated user if the token
|
|
# is accessible (e.g., via XSS). For production deployments, restrict to your domain(s):
|
|
# TB_CORS_ALLOWED_ORIGIN_PATTERNS=https://your-domain.com
|
|
# For multi-domain deployments, list all allowed domains comma-separated:
|
|
# TB_CORS_ALLOWED_ORIGIN_PATTERNS=https://domain1.com,https://domain2.com
|
|
spring.mvc.cors:
|
|
mappings:
|
|
# Intercept path
|
|
"[/api/**]":
|
|
#Comma-separated list of origins to allow. '*' allows all origins. When not set, CORS support is disabled.
|
|
allowed-origin-patterns: "${TB_CORS_ALLOWED_ORIGIN_PATTERNS:*}"
|
|
#Comma-separated list of methods to allow. '*' allows all methods.
|
|
allowed-methods: "${TB_CORS_ALLOWED_METHODS:*}"
|
|
#Comma-separated list of headers to allow in a request. '*' allows all headers.
|
|
allowed-headers: "${TB_CORS_ALLOWED_HEADERS:*}"
|
|
#How long, in seconds, the response from a pre-flight request can be cached by clients.
|
|
max-age: "${TB_CORS_MAX_AGE:1800}"
|
|
#Set whether credentials are supported. When not set, credentials are not supported.
|
|
allow-credentials: "${TB_CORS_ALLOW_CREDENTIALS:true}"
|
|
|
|
# General spring parameters
|
|
# Miscellaneous Spring Boot settings for circular references, Freemarker, MVC, multipart, and JPA dialect.
|
|
spring.main.allow-circular-references: "true" # Spring Boot configuration property that controls whether circular dependencies between beans are allowed.
|
|
spring.freemarker.checkTemplateLocation: "false" # spring freemarker configuration
|
|
spring.mvc.async.request-timeout: "${SPRING_MVC_ASYNC_REQUEST_TIMEOUT:30000}" # The default timeout for asynchronous requests in milliseconds
|
|
spring.mvc.pathmatch.matching-strategy: "ANT_PATH_MATCHER" # For endpoints matching in Swagger
|
|
spring.resources.chain:
|
|
compressed: "true" # This property enables or disables support for serving pre-compressed resources (for example, a .gzip or .br file)
|
|
strategy:
|
|
content:
|
|
enabled: "true" # This property enables or disables the content Version Strategy. This strategy allows Spring to generate a unique version for static resources, which is based on the content of the resource
|
|
|
|
spring.servlet.multipart.max-file-size: "${SPRING_SERVLET_MULTIPART_MAX_FILE_SIZE:50MB}" # Total file size cannot exceed 50MB when configuring file uploads
|
|
spring.servlet.multipart.max-request-size: "${SPRING_SERVLET_MULTIPART_MAX_REQUEST_SIZE:50MB}" # Total request size for a multipart/form-data cannot exceed 50MB
|
|
|
|
spring.jpa.properties.hibernate.jdbc.lob.non_contextual_creation: "true" #Fix Postgres JPA Error (Method org.postgresql.jdbc.PgConnection.createClob() is not yet implemented)
|
|
spring.jpa.properties.hibernate.order_by.default_null_ordering: "${SPRING_JPA_PROPERTIES_HIBERNATE_ORDER_BY_DEFAULT_NULL_ORDERING:last}" # Note: as for current Spring JPA version, custom NullHandling for the Sort.Order is ignored and this parameter is used
|
|
spring.jpa.properties.hibernate.dialect: "${SPRING_JPA_DIALECT:org.thingsboard.server.dao.ThingsboardPostgreSQLDialect}" # we use custom dialect that contains ilike(arg1, arg2) function (is interpreted to postgres ILIKE operator)
|
|
|
|
# SQL DAO Configuration parameters
|
|
# Configures Spring JPA, Hibernate DDL, and HikariCP datasource connections for the primary and events databases.
|
|
spring:
|
|
data:
|
|
jpa:
|
|
repositories:
|
|
enabled: "true" # Enable/Disable the Spring Data JPA repositories support
|
|
jpa:
|
|
properties:
|
|
jakarta.persistence.query.timeout: "${JAVAX_PERSISTENCE_QUERY_TIMEOUT:30000}" # General timeout for JDBC queries
|
|
open-in-view: "false" # Enabled by default. Therefore, database queries may be performed during view rendering. Explicitly configure spring.jpa.open-in-view to disable this warning
|
|
hibernate:
|
|
# You can set a Hibernate feature that controls the DDL behavior in a more fine-grained way. The standard Hibernate property values are none, validate, update, create-drop. Spring Boot chooses a default value for you based on whether it thinks your database is embedded (default create-drop) or not (default none)
|
|
ddl-auto: "none"
|
|
datasource:
|
|
# Database driver for Spring JPA - org.postgresql.Driver
|
|
driverClassName: "${SPRING_DRIVER_CLASS_NAME:org.postgresql.Driver}"
|
|
# Database connection URL
|
|
url: "${SPRING_DATASOURCE_URL:jdbc:postgresql://localhost:5432/thingsboard}"
|
|
# Database user name
|
|
username: "${SPRING_DATASOURCE_USERNAME:postgres}"
|
|
# Database user password
|
|
password: "${SPRING_DATASOURCE_PASSWORD:postgres}"
|
|
hikari:
|
|
# This property controls the amount of time that a connection can be out of the pool before a message is logged indicating a possible connection leak. A value of 0 means leak detection is disabled
|
|
leakDetectionThreshold: "${SPRING_DATASOURCE_HIKARI_LEAK_DETECTION_THRESHOLD:0}"
|
|
# This property increases the number of connections in the pool as demand increases. At the same time, the property ensures that the pool doesn't grow to the point of exhausting a system's resources, which ultimately affects an application's performance and availability
|
|
maximumPoolSize: "${SPRING_DATASOURCE_MAXIMUM_POOL_SIZE:16}"
|
|
# Enable MBean to diagnose pools state via JMX
|
|
registerMbeans: "${SPRING_DATASOURCE_HIKARI_REGISTER_MBEANS:false}"
|
|
events:
|
|
# Enable dedicated datasource (a separate database) for events and audit logs.
|
|
# Before enabling this, make sure you have set up the following tables in the new DB:
|
|
# error_event, lc_event, rule_chain_debug_event, rule_node_debug_event, stats_event, audit_log, cf_debug_event
|
|
enabled: "${SPRING_DEDICATED_EVENTS_DATASOURCE_ENABLED:false}"
|
|
# Database driver for Spring JPA for events datasource
|
|
driverClassName: "${SPRING_EVENTS_DATASOURCE_DRIVER_CLASS_NAME:org.postgresql.Driver}"
|
|
# Database connection URL for events datasource
|
|
url: "${SPRING_EVENTS_DATASOURCE_URL:jdbc:postgresql://localhost:5432/thingsboard_events}"
|
|
# Database username for events datasource
|
|
username: "${SPRING_EVENTS_DATASOURCE_USERNAME:postgres}"
|
|
# Database user password for events datasource
|
|
password: "${SPRING_EVENTS_DATASOURCE_PASSWORD:postgres}"
|
|
hikari:
|
|
# This property controls the amount of time that a connection can be out of the pool before a message is logged indicating a possible connection leak for events datasource. A value of 0 means leak detection is disabled
|
|
leakDetectionThreshold: "${SPRING_EVENTS_DATASOURCE_HIKARI_LEAK_DETECTION_THRESHOLD:0}"
|
|
# This property increases the number of connections in the pool as demand increases for events datasource. At the same time, the property ensures that the pool doesn't grow to the point of exhausting a system's resources, which ultimately affects an application's performance and availability
|
|
maximumPoolSize: "${SPRING_EVENTS_DATASOURCE_MAXIMUM_POOL_SIZE:4}"
|
|
# Enable MBean to diagnose pools state via JMX for events datasource
|
|
registerMbeans: "${SPRING_EVENTS_DATASOURCE_HIKARI_REGISTER_MBEANS:false}"
|
|
|
|
# Audit log parameters
|
|
# Configures audit logging levels per entity type and optional forwarding to an external sink such as Elasticsearch.
|
|
audit-log:
|
|
# Enable/disable audit log functionality.
|
|
enabled: "${AUDIT_LOG_ENABLED:true}"
|
|
# Logging levels per each entity type.
|
|
# Allowed values: OFF (disable), W (log write operations), RW (log read and write operations)
|
|
logging-level:
|
|
mask:
|
|
"device": "${AUDIT_LOG_MASK_DEVICE:W}" # Device logging levels.
|
|
"asset": "${AUDIT_LOG_MASK_ASSET:W}" # Asset logging levels.
|
|
"dashboard": "${AUDIT_LOG_MASK_DASHBOARD:W}" # Dashboard logging levels.
|
|
"widget_type": "${AUDIT_LOG_MASK_WIDGET_TYPE:W}" # Widget type logging levels.
|
|
"widgets_bundle": "${AUDIT_LOG_MASK_WIDGETS_BUNDLE:W}" # Widget bundles logging levels.
|
|
"customer": "${AUDIT_LOG_MASK_CUSTOMER:W}" # Customer logging levels.
|
|
"user": "${AUDIT_LOG_MASK_USER:W}" # User logging levels.
|
|
"rule_chain": "${AUDIT_LOG_MASK_RULE_CHAIN:W}" # Rule chain logging levels.
|
|
"alarm": "${AUDIT_LOG_MASK_ALARM:W}" # Alarm logging levels.
|
|
"entity_view": "${AUDIT_LOG_MASK_ENTITY_VIEW:W}" # Entity view logging levels.
|
|
"device_profile": "${AUDIT_LOG_MASK_DEVICE_PROFILE:W}" # Device profile logging levels.
|
|
"asset_profile": "${AUDIT_LOG_MASK_ASSET_PROFILE:W}" # Asset profile logging levels.
|
|
"edge": "${AUDIT_LOG_MASK_EDGE:W}" # Edge logging levels.
|
|
"tb_resource": "${AUDIT_LOG_MASK_RESOURCE:W}" # TB resource logging levels.
|
|
"ota_package": "${AUDIT_LOG_MASK_OTA_PACKAGE:W}" # Ota package logging levels.
|
|
"calculated_field": "${AUDIT_LOG_MASK_CALCULATED_FIELD:W}" # Calculated field logging levels.
|
|
"ai_model": "${AUDIT_LOG_MASK_AI_MODEL:W}" # AI model logging levels.
|
|
sink:
|
|
# Type of external sink. possible options: none, elasticsearch
|
|
type: "${AUDIT_LOG_SINK_TYPE:none}"
|
|
# Name of the index where audit logs are stored
|
|
# Index name could contain next placeholders (not mandatory):
|
|
# @{TENANT} - substituted by tenant ID
|
|
# @{DATE} - substituted by current date in format provided in audit_log.sink.date_format
|
|
index_pattern: "${AUDIT_LOG_SINK_INDEX_PATTERN:@{TENANT}_AUDIT_LOG_@{DATE}}"
|
|
# Date format. Details of the pattern can be found here:
|
|
# https://docs.oracle.com/javase/8/docs/api/java/time/format/DateTimeFormatter.html
|
|
date_format: "${AUDIT_LOG_SINK_DATE_FORMAT:YYYY.MM.dd}"
|
|
scheme_name: "${AUDIT_LOG_SINK_SCHEME_NAME:http}" # http or https
|
|
host: "${AUDIT_LOG_SINK_HOST:localhost}" # Host of external sink system
|
|
port: "${AUDIT_LOG_SINK_PORT:9200}" # Port of external sink system
|
|
user_name: "${AUDIT_LOG_SINK_USER_NAME:}" # Username used to access external sink system
|
|
password: "${AUDIT_LOG_SINK_PASSWORD:}" # Password used to access external sink system
|
|
|
|
# Device state parameters
|
|
# Configures device inactivity detection, state persistence strategy, and rate limits for state rule nodes.
|
|
state:
|
|
# Device inactivity timeout is a global configuration parameter that defines when the device will be marked as "inactive" by the server.
|
|
# The parameter value is in seconds. A user can overwrite this parameter for an individual device by setting the “inactivityTimeout” server-side attribute (NOTE: expects value in milliseconds).
|
|
# We recommend this parameter to be in sync with session inactivity timeout ("transport.sessions.inactivity_timeout" or TB_TRANSPORT_SESSIONS_INACTIVITY_TIMEOUT) parameter
|
|
# which is responsible for detection of the stale device connection sessions.
|
|
# The value of the session inactivity timeout parameter should be greater or equal to the device inactivity timeout.
|
|
# Note that the session inactivity timeout is set in milliseconds while device inactivity timeout is in seconds.
|
|
defaultInactivityTimeoutInSec: "${DEFAULT_INACTIVITY_TIMEOUT:600}"
|
|
defaultStateCheckIntervalInSec: "${DEFAULT_STATE_CHECK_INTERVAL:60}" # Interval for checking the device state after a specified period. Time in seconds
|
|
# Controls whether we store the device 'active' flag in attributes (default) or telemetry.
|
|
# If you decide to change this parameter, you should re-create the device info view as one of the following:
|
|
# If 'persistToTelemetry' is changed from 'false' to 'true': 'CREATE OR REPLACE VIEW device_info_view AS SELECT * FROM device_info_active_ts_view;'
|
|
# If 'persistToTelemetry' is changed from 'true' to 'false': 'CREATE OR REPLACE VIEW device_info_view AS SELECT * FROM device_info_active_attribute_view;'
|
|
persistToTelemetry: "${PERSIST_STATE_TO_TELEMETRY:false}"
|
|
# Millisecond value defining time-to-live for device state telemetry data (e.g. 'active', 'lastActivityTime').
|
|
# Used only when state.persistToTelemetry is set to 'true' and Cassandra is used for timeseries data.
|
|
# 0 means time-to-live mechanism is disabled.
|
|
telemetryTtl: "${STATE_TELEMETRY_TTL:0}"
|
|
# Number of device records to fetch per batch when initializing device activity states
|
|
initFetchPackSize: "${TB_DEVICE_STATE_INIT_FETCH_PACK_SIZE:50000}"
|
|
# Configuration properties for rule nodes related to device activity state
|
|
rule:
|
|
node:
|
|
# Device state rule node
|
|
deviceState:
|
|
# Defines the rate at which device connectivity events can be triggered.
|
|
# Comma-separated list of capacity:duration pairs that define bandwidth capacity and refill duration for token bucket rate limit algorithm.
|
|
# Refill is set to be greedy. Please refer to Bucket4j library documentation for more details.
|
|
rateLimit: "${DEVICE_STATE_NODE_RATE_LIMIT_CONFIGURATION:1:1,30:60,60:3600}"
|
|
|
|
# TBEL parameters
|
|
# Configures the ThingsBoard Expression Language (TBEL) engine: limits, timeouts, thread pool, and blacklisting.
|
|
tbel:
|
|
# Enable/Disable TBEL feature.
|
|
enabled: "${TBEL_ENABLED:true}"
|
|
# Limit the number of arguments that are passed to the function to execute the script
|
|
max_total_args_size: "${TBEL_MAX_TOTAL_ARGS_SIZE:100000}"
|
|
# Maximum allowed symbols in a result after processing a script
|
|
max_result_size: "${TBEL_MAX_RESULT_SIZE:300000}"
|
|
# Maximum allowed symbols in the script body
|
|
max_script_body_size: "${TBEL_MAX_SCRIPT_BODY_SIZE:50000}"
|
|
# Maximum allowed TBEL script execution memory
|
|
max_memory_limit_mb: "${TBEL_MAX_MEMORY_LIMIT_MB: 8}"
|
|
# Maximum allowed TBEL script execution errors before it will be blacklisted
|
|
max_errors: "${TBEL_MAX_ERRORS:3}"
|
|
# TBEL Eval max request timeout in milliseconds. 0 - no timeout
|
|
max_requests_timeout: "${TBEL_MAX_REQUEST_TIMEOUT:500}"
|
|
# Maximum time in seconds for black listed function to stay in the list.
|
|
max_black_list_duration_sec: "${TBEL_MAX_BLACKLIST_DURATION_SEC:60}"
|
|
# Specify thread pool size for javascript executor service
|
|
thread_pool_size: "${TBEL_THREAD_POOL_SIZE:50}"
|
|
# Maximum cache size of TBEL compiled scripts
|
|
compiled_scripts_cache_size: "${TBEL_COMPILED_SCRIPTS_CACHE_SIZE:1000}"
|
|
stats:
|
|
# Enable/Disable stats collection for TBEL engine
|
|
enabled: "${TB_TBEL_STATS_ENABLED:false}"
|
|
# Interval of logging for TBEL stats
|
|
print_interval_ms: "${TB_TBEL_STATS_PRINT_INTERVAL_MS:10000}"
|
|
|
|
# JS parameters
|
|
# Configures the JavaScript execution engine (local Nashorn or remote Node.js): limits, sandboxing, and thread pools.
|
|
js:
|
|
# local (Nashorn Engine, deprecated) OR remote JS-Executors (NodeJS)
|
|
evaluator: "${JS_EVALUATOR:local}"
|
|
# Limit the number of arguments that are passed to the function to execute the script
|
|
max_total_args_size: "${JS_MAX_TOTAL_ARGS_SIZE:100000}"
|
|
# Maximum allowed symbols in a result after processing a script
|
|
max_result_size: "${JS_MAX_RESULT_SIZE:300000}"
|
|
# Maximum allowed symbols in script body
|
|
max_script_body_size: "${JS_MAX_SCRIPT_BODY_SIZE:50000}"
|
|
# Built-in JVM JavaScript environment properties
|
|
local:
|
|
# Specify thread pool size for javascript executor service
|
|
js_thread_pool_size: "${LOCAL_JS_THREAD_POOL_SIZE:50}"
|
|
# Use Sandboxed (secured) JVM JavaScript environment
|
|
use_js_sandbox: "${USE_LOCAL_JS_SANDBOX:true}"
|
|
# Specify thread pool size for JavaScript sandbox resource monitor
|
|
monitor_thread_pool_size: "${LOCAL_JS_SANDBOX_MONITOR_THREAD_POOL_SIZE:4}"
|
|
# Maximum CPU time in milliseconds allowed for script execution
|
|
max_cpu_time: "${LOCAL_JS_SANDBOX_MAX_CPU_TIME:8000}"
|
|
# Maximum memory in Bytes which JS executor thread can allocate (approximate calculation). A zero memory limit in combination with a non-zero CPU limit is not recommended due to the implementation of Nashorn 0.4.2. 100MiB is effectively unlimited for most cases
|
|
max_memory: "${LOCAL_JS_SANDBOX_MAX_MEMORY:104857600}"
|
|
# Maximum allowed JavaScript execution errors before JavaScript will be blacklisted
|
|
max_errors: "${LOCAL_JS_SANDBOX_MAX_ERRORS:3}"
|
|
# JS Eval max request timeout. 0 - no timeout
|
|
max_requests_timeout: "${LOCAL_JS_MAX_REQUEST_TIMEOUT:0}"
|
|
# Maximum time in seconds for black listed function to stay in the list.
|
|
max_black_list_duration_sec: "${LOCAL_JS_SANDBOX_MAX_BLACKLIST_DURATION_SEC:60}"
|
|
stats:
|
|
# Enable/Disable stats collection for local JS executor
|
|
enabled: "${TB_JS_LOCAL_STATS_ENABLED:false}"
|
|
# Interval of logging for local JS executor stats
|
|
print_interval_ms: "${TB_JS_LOCAL_STATS_PRINT_INTERVAL_MS:10000}"
|
|
# Remote JavaScript environment properties
|
|
remote:
|
|
# Specify thread pool size for javascript executor service
|
|
js_thread_pool_size: "${REMOTE_JS_THREAD_POOL_SIZE:50}"
|
|
# Maximum allowed JavaScript execution errors before JavaScript will be blacklisted
|
|
max_errors: "${REMOTE_JS_SANDBOX_MAX_ERRORS:3}"
|
|
# Maximum time in seconds for black listed function to stay in the list.
|
|
max_black_list_duration_sec: "${REMOTE_JS_SANDBOX_MAX_BLACKLIST_DURATION_SEC:60}"
|
|
stats:
|
|
# Enable/Disable stats collection for remote JS executor
|
|
enabled: "${TB_JS_REMOTE_STATS_ENABLED:false}"
|
|
# Interval of logging for remote JS executor stats
|
|
print_interval_ms: "${TB_JS_REMOTE_STATS_PRINT_INTERVAL_MS:10000}"
|
|
|
|
# Transport configuration parameters
|
|
# Configures session management, rate limits, and protocol-specific settings for HTTP, MQTT, CoAP, LwM2M, and SNMP transports.
|
|
transport:
|
|
sessions:
|
|
# Session inactivity timeout is a global configuration parameter that defines how long the device transport session will be opened after the last message arrives from the device.
|
|
# The parameter value is in milliseconds.
|
|
# The last activity time of the device session is updated if the device sends any message, including keepalive messages
|
|
# If there is no activity, the session will be closed, and all subscriptions will be deleted.
|
|
# We recommend this parameter to be in sync with device inactivity timeout ("state.defaultInactivityTimeoutInSec" or DEFAULT_INACTIVITY_TIMEOUT) parameter
|
|
# which is responsible for detection of the device connectivity status in the core service of the platform.
|
|
# The value of the session inactivity timeout parameter should be greater or equal to the device inactivity timeout.
|
|
# Note that the session inactivity timeout is set in milliseconds while device inactivity timeout is in seconds.
|
|
inactivity_timeout: "${TB_TRANSPORT_SESSIONS_INACTIVITY_TIMEOUT:600000}"
|
|
# Interval of periodic check for expired sessions and report of the changes to session last activity time
|
|
report_timeout: "${TB_TRANSPORT_SESSIONS_REPORT_TIMEOUT:3000}"
|
|
activity:
|
|
# This property specifies the strategy for reporting activity events within each reporting period.
|
|
# The accepted values are 'FIRST', 'LAST', 'FIRST_AND_LAST' and 'ALL'.
|
|
# <ul><li> 'FIRST': Only the first activity event in each reporting period is reported.</li>
|
|
# <li> 'LAST': Only the last activity event in the reporting period is reported.</li>
|
|
# <li> 'FIRST_AND_LAST': Both the first and last activity events in the reporting period are reported.</li>
|
|
# <li> 'ALL': All activity events in the reporting period are reported.</li></ul>
|
|
reporting_strategy: "${TB_TRANSPORT_ACTIVITY_REPORTING_STRATEGY:LAST}"
|
|
json:
|
|
# Cast String data types to Numeric if possible when processing Telemetry/Attributes JSON
|
|
type_cast_enabled: "${JSON_TYPE_CAST_ENABLED:true}"
|
|
# Maximum allowed string value length when processing Telemetry/Attributes JSON (0 value disables string value length check)
|
|
max_string_value_length: "${JSON_MAX_STRING_VALUE_LENGTH:0}"
|
|
client_side_rpc:
|
|
# Processing timeout interval of the RPC command on the CLIENT SIDE. Time in milliseconds
|
|
timeout: "${CLIENT_SIDE_RPC_TIMEOUT:60000}"
|
|
# Enable/disable http/mqtt/coap/lwm2m transport protocols (has higher priority than certain protocol's 'enabled' property)
|
|
api_enabled: "${TB_TRANSPORT_API_ENABLED:true}"
|
|
log:
|
|
# Enable/Disable log of transport messages to telemetry. For example, logging of LwM2M registration update
|
|
enabled: "${TB_TRANSPORT_LOG_ENABLED:true}"
|
|
# Maximum length of the log message. The content will be truncated to the specified value if needed
|
|
max_length: "${TB_TRANSPORT_LOG_MAX_LENGTH:1024}"
|
|
rate_limits:
|
|
# Enable or disable generic rate limits. Device and Tenant-specific rate limits are controlled in Tenant Profile.
|
|
ip_limits_enabled: "${TB_TRANSPORT_IP_RATE_LIMITS_ENABLED:false}"
|
|
# Maximum number of connect attempts with invalid credentials
|
|
max_wrong_credentials_per_ip: "${TB_TRANSPORT_MAX_WRONG_CREDENTIALS_PER_IP:10}"
|
|
# Timeout (in milliseconds) to expire block IP addresses
|
|
ip_block_timeout: "${TB_TRANSPORT_IP_BLOCK_TIMEOUT:60000}"
|
|
# Local HTTP transport parameters
|
|
http:
|
|
# Enable/Disable local HTTP transport protocol
|
|
enabled: "${HTTP_ENABLED:true}"
|
|
# HTTP request processing timeout in milliseconds
|
|
request_timeout: "${HTTP_REQUEST_TIMEOUT:60000}"
|
|
# HTTP maximum request processing timeout in milliseconds
|
|
max_request_timeout: "${HTTP_MAX_REQUEST_TIMEOUT:300000}"
|
|
# Semi-colon-separated list of urlPattern=maxPayloadSize pairs that define max http request size for specified url pattern. After first match all other will be skipped
|
|
max_payload_size: "${HTTP_TRANSPORT_MAX_PAYLOAD_SIZE_LIMIT_CONFIGURATION:/api/v1/*/rpc/**=65536;/api/v1/**=52428800}"
|
|
# Local MQTT transport parameters
|
|
mqtt:
|
|
# Enable/disable mqtt transport protocol.
|
|
enabled: "${MQTT_ENABLED:true}"
|
|
# MQTT bind-address
|
|
bind_address: "${MQTT_BIND_ADDRESS:0.0.0.0}"
|
|
# MQTT bind port
|
|
bind_port: "${MQTT_BIND_PORT:1883}"
|
|
# Enable proxy protocol support. Disabled by default. If enabled, supports both v1 and v2.
|
|
# Useful to get the real IP address of the client in the logs and for rate limits.
|
|
proxy_enabled: "${MQTT_PROXY_PROTOCOL_ENABLED:false}"
|
|
# MQTT processing timeout in milliseconds
|
|
timeout: "${MQTT_TIMEOUT:10000}"
|
|
# MQTT disconnect timeout in milliseconds. The time to wait for the client to disconnect after the server sends a disconnect message.
|
|
disconnect_timeout: "${MQTT_DISCONNECT_TIMEOUT:1000}"
|
|
msg_queue_size_per_device_limit: "${MQTT_MSG_QUEUE_SIZE_PER_DEVICE_LIMIT:100}" # messages await in the queue before the device connected state. This limit works on the low level before TenantProfileLimits mechanism
|
|
# Interval of periodic report of the gateway metrics
|
|
gateway_metrics_report_interval_sec: "${MQTT_GATEWAY_METRICS_REPORT_INTERVAL_SEC:60}"
|
|
netty:
|
|
# Netty leak detector level
|
|
leak_detector_level: "${NETTY_LEAK_DETECTOR_LVL:DISABLED}"
|
|
# Netty BOSS threads count
|
|
boss_group_thread_count: "${NETTY_BOSS_GROUP_THREADS:1}"
|
|
# Netty worker threads count
|
|
worker_group_thread_count: "${NETTY_WORKER_GROUP_THREADS:12}"
|
|
# Max payload size in bytes
|
|
max_payload_size: "${NETTY_MAX_PAYLOAD_SIZE:65536}"
|
|
# Enables TCP keepalive. This means that TCP starts sending keepalive probes when a connection is idle for some time
|
|
so_keep_alive: "${NETTY_SO_KEEPALIVE:false}"
|
|
# MQTT SSL configuration
|
|
ssl:
|
|
# Enable/disable SSL support
|
|
enabled: "${MQTT_SSL_ENABLED:false}"
|
|
# MQTT SSL bind-address
|
|
bind_address: "${MQTT_SSL_BIND_ADDRESS:0.0.0.0}"
|
|
# MQTT SSL bind port
|
|
bind_port: "${MQTT_SSL_BIND_PORT:8883}"
|
|
# SSL protocol: See https://docs.oracle.com/en/java/javase/11/docs/specs/security/standard-names.html#sslcontext-algorithms
|
|
protocol: "${MQTT_SSL_PROTOCOL:TLSv1.2}"
|
|
# Server SSL credentials
|
|
credentials:
|
|
# Server credentials type (PEM - pem certificate file; KEYSTORE - java keystore)
|
|
type: "${MQTT_SSL_CREDENTIALS_TYPE:PEM}"
|
|
# PEM server credentials
|
|
pem:
|
|
# Path to the server certificate file (holds server certificate or certificate chain, may include server private key)
|
|
cert_file: "${MQTT_SSL_PEM_CERT:mqttserver.pem}"
|
|
# Path to the server certificate private key file. Optional by default. Required if the private key is not present in server certificate file;
|
|
key_file: "${MQTT_SSL_PEM_KEY:mqttserver_key.pem}"
|
|
# Server certificate private key password (optional)
|
|
key_password: "${MQTT_SSL_PEM_KEY_PASSWORD:server_key_password}"
|
|
# Keystore server credentials
|
|
keystore:
|
|
# Type of the key store (JKS or PKCS12)
|
|
type: "${MQTT_SSL_KEY_STORE_TYPE:JKS}"
|
|
# Path to the key store that holds the SSL certificate
|
|
store_file: "${MQTT_SSL_KEY_STORE:mqttserver.jks}"
|
|
# Password used to access the key store
|
|
store_password: "${MQTT_SSL_KEY_STORE_PASSWORD:server_ks_password}"
|
|
# Optional alias of the private key. If not set, the platform will load the first private key from the keystore
|
|
key_alias: "${MQTT_SSL_KEY_ALIAS:}"
|
|
# Optional password to access the private key. If not set, the platform will attempt to load the private keys that are not protected with the password;
|
|
key_password: "${MQTT_SSL_KEY_PASSWORD:server_key_password}"
|
|
# Skip certificate validity check for client certificates.
|
|
skip_validity_check_for_client_cert: "${MQTT_SSL_SKIP_VALIDITY_CHECK_FOR_CLIENT_CERT:false}"
|
|
# Local CoAP transport parameters
|
|
coap:
|
|
# Enable/disable CoAP transport protocol.
|
|
enabled: "${COAP_ENABLED:true}"
|
|
# CoaP processing timeout in milliseconds
|
|
timeout: "${COAP_TIMEOUT:10000}"
|
|
# CoaP piggyback response timeout in milliseconds
|
|
piggyback_timeout: "${COAP_PIGGYBACK_TIMEOUT:500}"
|
|
# Default PSM Activity Timer if not specified in device profile
|
|
psm_activity_timer: "${COAP_PSM_ACTIVITY_TIMER:10000}"
|
|
# Default PSM Activity Timer if not specified in device profile
|
|
paging_transmission_window: "${COAP_PAGING_TRANSMISSION_WINDOW:10000}"
|
|
# Local LwM2M transport parameters
|
|
lwm2m:
|
|
# Enable/disable LwM2M transport protocol.
|
|
enabled: "${LWM2M_ENABLED:true}"
|
|
dtls:
|
|
# RFC7925_RETRANSMISSION_TIMEOUT_IN_MILLISECONDS = 9000
|
|
retransmission_timeout: "${LWM2M_DTLS_RETRANSMISSION_TIMEOUT_MS:9000}"
|
|
# LWM2M DTLS connection ID length for LWM2M. RFC 9146, Connection Identifier for DTLS 1.2
|
|
# Default: off. <br>
|
|
# Control usage of DTLS connection ID length (CID).
|
|
# <ul> <li> 'off' to deactivate it. </li>
|
|
# <li> 'on' to activate Connection ID support (same as CID 0 or more 0). </li>
|
|
# <li> A positive value defines generated CID size in bytes.</li>
|
|
# <li> A value of 0 means we accept using CID but will not generate one for foreign peer (enables support but not for incoming traffic). </li>
|
|
# <li> A value between 0 and <= 4: SingleNodeConnectionIdGenerator is used </li>
|
|
# <li> A value that are > 4: MultiNodeConnectionIdGenerator is used </li> </ul>
|
|
connection_id_length: "${LWM2M_DTLS_CONNECTION_ID_LENGTH:8}"
|
|
server:
|
|
# LwM2M Server ID
|
|
id: "${LWM2M_SERVER_ID:123}"
|
|
# LwM2M server bind address. Bind to all interfaces by default
|
|
bind_address: "${LWM2M_BIND_ADDRESS:0.0.0.0}"
|
|
# LwM2M server bind port
|
|
bind_port: "${LWM2M_BIND_PORT:5685}"
|
|
security:
|
|
# LwM2M server bind address for DTLS. Bind to all interfaces by default
|
|
bind_address: "${LWM2M_SECURITY_BIND_ADDRESS:0.0.0.0}"
|
|
# LwM2M server bind port for DTLS
|
|
bind_port: "${LWM2M_SECURITY_BIND_PORT:5686}"
|
|
# Server X509 Certificates support
|
|
credentials:
|
|
# Whether to enable LWM2M server X509 Certificate/RPK support
|
|
enabled: "${LWM2M_SERVER_CREDENTIALS_ENABLED:false}"
|
|
# Server credentials type (PEM - pem certificate file; KEYSTORE - java keystore)
|
|
type: "${LWM2M_SERVER_CREDENTIALS_TYPE:PEM}"
|
|
# PEM server credentials
|
|
pem:
|
|
# Path to the server certificate file (holds server certificate or certificate chain, may include server private key)
|
|
cert_file: "${LWM2M_SERVER_PEM_CERT:lwm2mserver.pem}"
|
|
# Path to the server certificate private key file. Optional by default. Required if the private key is not present in the server certificate file;
|
|
key_file: "${LWM2M_SERVER_PEM_KEY:lwm2mserver_key.pem}"
|
|
# Server certificate private key password (optional)
|
|
key_password: "${LWM2M_SERVER_PEM_KEY_PASSWORD:server_key_password}"
|
|
# Keystore server credentials
|
|
keystore:
|
|
# Type of the key store (JKS or PKCS12)
|
|
type: "${LWM2M_SERVER_KEY_STORE_TYPE:JKS}"
|
|
# Path to the key store that holds the SSL certificate
|
|
store_file: "${LWM2M_SERVER_KEY_STORE:lwm2mserver.jks}"
|
|
# Password used to access the key store
|
|
store_password: "${LWM2M_SERVER_KEY_STORE_PASSWORD:server_ks_password}"
|
|
# Key alias
|
|
key_alias: "${LWM2M_SERVER_KEY_ALIAS:server}"
|
|
# Password used to access the key
|
|
key_password: "${LWM2M_SERVER_KEY_PASSWORD:server_ks_password}"
|
|
# Only Certificate_x509:
|
|
skip_validity_check_for_client_cert: "${TB_LWM2M_SERVER_SECURITY_SKIP_VALIDITY_CHECK_FOR_CLIENT_CERT:false}"
|
|
bootstrap:
|
|
# Enable/disable Bootstrap Server
|
|
enabled: "${LWM2M_ENABLED_BS:true}"
|
|
# Default value in LwM2M client after start in mode Bootstrap for the object : name "LWM2M Security" field: "Short Server ID" (deviceProfile: Bootstrap.BOOTSTRAP SERVER.Short ID)
|
|
id: "${LWM2M_SERVER_ID_BS:0}"
|
|
# LwM2M bootstrap server bind address. Bind to all interfaces by default
|
|
bind_address: "${LWM2M_BS_BIND_ADDRESS:0.0.0.0}"
|
|
# LwM2M bootstrap server bind port
|
|
bind_port: "${LWM2M_BS_BIND_PORT:5687}"
|
|
security:
|
|
# LwM2M bootstrap server bind address for DTLS. Bind to all interfaces by default
|
|
bind_address: "${LWM2M_BS_SECURITY_BIND_ADDRESS:0.0.0.0}"
|
|
# LwM2M bootstrap server bind address for DTLS. Bind to all interfaces by default
|
|
bind_port: "${LWM2M_BS_SECURITY_BIND_PORT:5688}"
|
|
# Bootstrap server X509 Certificates support
|
|
credentials:
|
|
# Whether to enable LWM2M bootstrap server X509 Certificate/RPK support
|
|
enabled: "${LWM2M_BS_CREDENTIALS_ENABLED:false}"
|
|
# Server credentials type (PEM - pem certificate file; KEYSTORE - java keystore)
|
|
type: "${LWM2M_BS_CREDENTIALS_TYPE:PEM}"
|
|
# PEM server credentials
|
|
pem:
|
|
# Path to the server certificate file (holds server certificate or certificate chain, may include server private key)
|
|
cert_file: "${LWM2M_BS_PEM_CERT:lwm2mserver.pem}"
|
|
# Path to the server certificate private key file. Optional by default. Required if the private key is not present in server certificate file
|
|
key_file: "${LWM2M_BS_PEM_KEY:lwm2mserver_key.pem}"
|
|
# Server certificate private key password (optional)
|
|
key_password: "${LWM2M_BS_PEM_KEY_PASSWORD:server_key_password}"
|
|
# Keystore server credentials
|
|
keystore:
|
|
# Type of the key store (JKS or PKCS12)
|
|
type: "${LWM2M_BS_KEY_STORE_TYPE:JKS}"
|
|
# Path to the key store that holds the SSL certificate
|
|
store_file: "${LWM2M_BS_KEY_STORE:lwm2mserver.jks}"
|
|
# Password used to access the key store
|
|
store_password: "${LWM2M_BS_KEY_STORE_PASSWORD:server_ks_password}"
|
|
# Key alias
|
|
key_alias: "${LWM2M_BS_KEY_ALIAS:bootstrap}"
|
|
# Password used to access the key
|
|
key_password: "${LWM2M_BS_KEY_PASSWORD:server_ks_password}"
|
|
security:
|
|
# X509 trust certificates
|
|
trust-credentials:
|
|
# Whether to load X509 trust certificates
|
|
enabled: "${LWM2M_TRUST_CREDENTIALS_ENABLED:false}"
|
|
# Trust certificates store type (PEM - pem certificates file; KEYSTORE - java keystore)
|
|
type: "${LWM2M_TRUST_CREDENTIALS_TYPE:PEM}"
|
|
# PEM certificates
|
|
pem:
|
|
# Path to the certificates file (holds trust certificates)
|
|
cert_file: "${LWM2M_TRUST_PEM_CERT:lwm2mtruststorechain.pem}"
|
|
# Keystore with trust certificates
|
|
keystore:
|
|
# Type of the key store (JKS or PKCS12)
|
|
type: "${LWM2M_TRUST_KEY_STORE_TYPE:JKS}"
|
|
# Path to the key store that holds the X509 certificates
|
|
store_file: "${LWM2M_TRUST_KEY_STORE:lwm2mtruststorechain.jks}"
|
|
# Password used to access the key store
|
|
store_password: "${LWM2M_TRUST_KEY_STORE_PASSWORD:server_ks_password}"
|
|
# Set usage of recommended cipher suites; true - allow only recommended cipher suites; false - allow not recommended cipher suites
|
|
recommended_ciphers: "${LWM2M_RECOMMENDED_CIPHERS:false}"
|
|
# Set usage of recommended supported groups (curves); true - allow only recommended supported groups, false - allow not recommended supported groups
|
|
recommended_supported_groups: "${LWM2M_RECOMMENDED_SUPPORTED_GROUPS:true}"
|
|
# Timeout of LwM2M operation
|
|
timeout: "${LWM2M_TIMEOUT:120000}"
|
|
# Thread pool size for processing of the LwM2M uplinks
|
|
uplink_pool_size: "${LWM2M_UPLINK_POOL_SIZE:10}"
|
|
# Thread pool size for processing of the LwM2M downlinks
|
|
downlink_pool_size: "${LWM2M_DOWNLINK_POOL_SIZE:10}"
|
|
# Thread pool size for processing of the OTA updates
|
|
ota_pool_size: "${LWM2M_OTA_POOL_SIZE:10}"
|
|
# Period of cleanup for the registrations in store
|
|
clean_period_in_sec: "${LWM2M_CLEAN_PERIOD_IN_SEC:2}"
|
|
# Maximum log size
|
|
log_max_length: "${LWM2M_LOG_MAX_LENGTH:1024}"
|
|
# PSM Activity Timer if not specified in the device profile
|
|
psm_activity_timer: "${LWM2M_PSM_ACTIVITY_TIMER:10000}"
|
|
# Paging Transmission Window for eDRX support if not specified in the device profile
|
|
paging_transmission_window: "${LWM2M_PAGING_TRANSMISSION_WINDOW:10000}"
|
|
network_config: # In this section you can specify custom parameters for LwM2M network configuration and expose the env variables to configure outside
|
|
# - key: "PROTOCOL_STAGE_THREAD_COUNT"
|
|
# value: "${LWM2M_PROTOCOL_STAGE_THREAD_COUNT:4}"
|
|
snmp:
|
|
# Enable/disable SNMP transport protocol
|
|
enabled: "${SNMP_ENABLED:true}"
|
|
# SNMP bind address
|
|
bind_address: "${SNMP_BIND_ADDRESS:0.0.0.0}"
|
|
# SNMP bind port. Zero (random) by default. When using SNMP TRAPs - make sure to specify some static value, e.g. 1620
|
|
bind_port: "${SNMP_BIND_PORT:0}"
|
|
response_processing:
|
|
# parallelism level for executor (workStealingPool) that is responsible for handling responses from SNMP devices
|
|
parallelism_level: "${SNMP_RESPONSE_PROCESSING_PARALLELISM_LEVEL:4}"
|
|
# to configure SNMP to work over UDP or TCP
|
|
underlying_protocol: "${SNMP_UNDERLYING_PROTOCOL:udp}"
|
|
# Maximum size of a PDU (amount of OID mappings in a single SNMP request). The request will be split into multiple PDUs if mappings amount exceeds this number
|
|
max_request_oids: "${SNMP_MAX_REQUEST_OIDS:100}"
|
|
# Delay after sending each request chunk (in case the request was split into multiple PDUs due to max_request_oids)
|
|
request_chunk_delay_ms: "${SNMP_REQUEST_CHUNK_DELAY_MS:100}"
|
|
response:
|
|
# To ignore SNMP response values that do not match the data type of the configured OID mapping (by default false - will throw an error if any value of the response not match configured data types)
|
|
ignore_type_cast_errors: "${SNMP_RESPONSE_IGNORE_TYPE_CAST_ERRORS:false}"
|
|
# Thread pool size for scheduler that executes device querying tasks
|
|
scheduler_thread_pool_size: "${SNMP_SCHEDULER_THREAD_POOL_SIZE:4}"
|
|
# Maximum number of retry attempts for a single SNMP devices batch during bootstrap.
|
|
batch_retries: "${SNMP_BOOTSTRAP_RETRIES:8}"
|
|
stats:
|
|
# Enable/Disable the collection of transport statistics
|
|
enabled: "${TB_TRANSPORT_STATS_ENABLED:true}"
|
|
# Interval of transport statistics logging
|
|
print-interval-ms: "${TB_TRANSPORT_STATS_PRINT_INTERVAL_MS:60000}"
|
|
gateway:
|
|
dashboard:
|
|
sync:
|
|
# Enable/disable gateways dashboard sync with git repository
|
|
enabled: "${TB_GATEWAY_DASHBOARD_SYNC_ENABLED:true}"
|
|
# URL of gateways dashboard repository
|
|
repository_url: "${TB_GATEWAY_DASHBOARD_SYNC_REPOSITORY_URL:https://github.com/thingsboard/gateway-management-extensions-dist.git}"
|
|
# Branch of gateways dashboard repository to work with
|
|
branch: "${TB_GATEWAY_DASHBOARD_SYNC_BRANCH:release/4.3.0}"
|
|
# Fetch frequency in hours for gateways dashboard repository
|
|
fetch_frequency: "${TB_GATEWAY_DASHBOARD_SYNC_FETCH_FREQUENCY:24}"
|
|
|
|
# CoAP server parameters
|
|
# Configures the standalone CoAP server bind address, port, DTLS encryption, and credential settings.
|
|
coap:
|
|
server:
|
|
# Enable/disable coap server.
|
|
enabled: "${COAP_SERVER_ENABLED:true}"
|
|
# CoAP bind address
|
|
bind_address: "${COAP_BIND_ADDRESS:0.0.0.0}"
|
|
# CoAP bind port
|
|
bind_port: "${COAP_BIND_PORT:5683}"
|
|
dtls:
|
|
# Enable/disable DTLS 1.2 support
|
|
enabled: "${COAP_DTLS_ENABLED:false}"
|
|
# RFC7925_RETRANSMISSION_TIMEOUT_IN_MILLISECONDS = 9000
|
|
retransmission_timeout: "${COAP_DTLS_RETRANSMISSION_TIMEOUT_MS:9000}"
|
|
# CoAP DTLS bind address
|
|
bind_address: "${COAP_DTLS_BIND_ADDRESS:0.0.0.0}"
|
|
# CoAP DTLS bind port
|
|
bind_port: "${COAP_DTLS_BIND_PORT:5684}"
|
|
# CoAP DTLS connection ID length. RFC 9146, Connection Identifier for DTLS 1.2
|
|
# Default: off. <br>
|
|
# Control usage of DTLS connection ID length (CID).
|
|
# <ul> <li> 'off' to deactivate it. </li>
|
|
# <li> 'on' to activate Connection ID support (same as CID 0 or more 0). </li>
|
|
# <li> A positive value defines generated CID size in bytes.</li>
|
|
# <li> A value of 0 means we accept using CID but will not generate one for foreign peer (enables support but not for incoming traffic).</li>
|
|
# <li> A value between 0 and <= 4: SingleNodeConnectionIdGenerator is used</li>
|
|
# <li> A value that are > 4: MultiNodeConnectionIdGenerator is used</li> </ul>
|
|
connection_id_length: "${COAP_DTLS_CONNECTION_ID_LENGTH:8}"
|
|
# Specify the MTU (Maximum Transmission Unit).
|
|
# Should be used if LAN MTU is not used, e.g. if IP tunnels are used or if the client uses a smaller value than the LAN MTU.
|
|
# Default = 1024
|
|
# Minimum value = 64
|
|
# If set to 0 - LAN MTU is used.
|
|
max_transmission_unit: "${COAP_DTLS_MAX_TRANSMISSION_UNIT:1024}"
|
|
# DTLS maximum fragment length (RFC 6066, Section 4).
|
|
# Default = 1024
|
|
# Possible values: 512, 1024, 2048, 4096.
|
|
# If set to 0, the default maximum fragment size of 2^14 bytes (16,384 bytes) is used.
|
|
# Without this extension, TLS specifies a fixed maximum plaintext fragment length of 2^14 bytes.
|
|
# It may be desirable for constrained clients to negotiate a smaller maximum fragment length due to memory limitations or bandwidth limitations.
|
|
# In order to negotiate smaller maximum fragment lengths,
|
|
# clients MAY include an extension of type "max_fragment_length" in the (extended) client hello.
|
|
# The "extension_data" field of this extension SHALL contain:
|
|
# <pre> enum {
|
|
# 2^9(1) == 512,
|
|
# 2^10(2) == 1024,
|
|
# 2^11(3) == 2048,
|
|
# 2^12(4) == 4096,
|
|
# (255)
|
|
# } MaxFragmentLength; </pre>
|
|
# TLS already requires clients and servers to support fragmentation of handshake messages.
|
|
max_fragment_length: "${COAP_DTLS_MAX_FRAGMENT_LENGTH:1024}"
|
|
# Server DTLS credentials
|
|
credentials:
|
|
# Server credentials type (PEM - pem certificate file; KEYSTORE - java keystore)
|
|
type: "${COAP_DTLS_CREDENTIALS_TYPE:PEM}"
|
|
# PEM server credentials
|
|
pem:
|
|
# Path to the server certificate file (holds server certificate or certificate chain, may include server private key)
|
|
cert_file: "${COAP_DTLS_PEM_CERT:coapserver.pem}"
|
|
# Path to the server certificate private key file. Optional by default. Required if the private key is not present in the server certificate file;
|
|
key_file: "${COAP_DTLS_PEM_KEY:coapserver_key.pem}"
|
|
# Server certificate private key password (optional)
|
|
key_password: "${COAP_DTLS_PEM_KEY_PASSWORD:server_key_password}"
|
|
# Keystore server credentials
|
|
keystore:
|
|
# Type of the key store (JKS or PKCS12)
|
|
type: "${COAP_DTLS_KEY_STORE_TYPE:JKS}"
|
|
# Path to the key store that holds the SSL certificate
|
|
store_file: "${COAP_DTLS_KEY_STORE:coapserver.jks}"
|
|
# Password used to access the key store
|
|
store_password: "${COAP_DTLS_KEY_STORE_PASSWORD:server_ks_password}"
|
|
# Key alias
|
|
key_alias: "${COAP_DTLS_KEY_ALIAS:serveralias}"
|
|
# Password used to access the key
|
|
key_password: "${COAP_DTLS_KEY_PASSWORD:server_key_password}"
|
|
x509:
|
|
# Skip certificate validity check for client certificates.
|
|
skip_validity_check_for_client_cert: "${TB_COAP_X509_DTLS_SKIP_VALIDITY_CHECK_FOR_CLIENT_CERT:false}"
|
|
# Inactivity timeout of DTLS session. Used to cleanup cache
|
|
dtls_session_inactivity_timeout: "${TB_COAP_X509_DTLS_SESSION_INACTIVITY_TIMEOUT:86400000}"
|
|
# Interval of periodic eviction of the timed-out DTLS sessions
|
|
dtls_session_report_timeout: "${TB_COAP_X509_DTLS_SESSION_REPORT_TIMEOUT:1800000}"
|
|
|
|
# Device connectivity parameters
|
|
# Specifies the hosts, ports, and credentials exposed to the UI for generating device connection check commands.
|
|
device:
|
|
connectivity:
|
|
http:
|
|
# If true check-connectivity service will include curl command to the list of all test commands using DEVICE_CONNECTIVITY_HTTP_HOST and DEVICE_CONNECTIVITY_HTTP_PORT variables
|
|
enabled: "${DEVICE_CONNECTIVITY_HTTP_ENABLED:true}"
|
|
# Host of http transport service. If empty, the base URL will be used.
|
|
host: "${DEVICE_CONNECTIVITY_HTTP_HOST:}"
|
|
# Port of http transport service. If empty, default http port will be used.
|
|
port: "${DEVICE_CONNECTIVITY_HTTP_PORT:8080}"
|
|
https:
|
|
# If true check-connectivity service will include curl command to the list of all test commands using DEVICE_CONNECTIVITY_HTTPS_HOST and DEVICE_CONNECTIVITY_HTTPS_PORT variables
|
|
enabled: "${DEVICE_CONNECTIVITY_HTTPS_ENABLED:false}"
|
|
# Host of http transport service. If empty, the base URL will be used.
|
|
host: "${DEVICE_CONNECTIVITY_HTTPS_HOST:}"
|
|
# Port of http transport service. If empty, the default https port will be used.
|
|
port: "${DEVICE_CONNECTIVITY_HTTPS_PORT:443}"
|
|
mqtt:
|
|
# If true mosquito command will be included to the list of all test commands using DEVICE_CONNECTIVITY_MQTT_HOST and DEVICE_CONNECTIVITY_MQTT_PORT
|
|
enabled: "${DEVICE_CONNECTIVITY_MQTT_ENABLED:true}"
|
|
# Host of mqtt transport service. If empty, the base url host will be used.
|
|
host: "${DEVICE_CONNECTIVITY_MQTT_HOST:}"
|
|
# Port of mqtt transport service
|
|
port: "${DEVICE_CONNECTIVITY_MQTT_PORT:1883}"
|
|
mqtts:
|
|
# If true mosquito command will be included in the list of all test commands using DEVICE_CONNECTIVITY_MQTTS_HOST and DEVICE_CONNECTIVITY_MQTTS_PORT<
|
|
enabled: "${DEVICE_CONNECTIVITY_MQTTS_ENABLED:false}"
|
|
# Host of mqtt transport service. If empty, the base URL host will be used.
|
|
host: "${DEVICE_CONNECTIVITY_MQTTS_HOST:}"
|
|
# Port of mqtt transport service. If empty, the default port for mqtts will be used.
|
|
port: "${DEVICE_CONNECTIVITY_MQTTS_PORT:8883}"
|
|
# Path to the MQTT CA root certificate file
|
|
pem_cert_file: "${DEVICE_CONNECTIVITY_MQTTS_CA_ROOT_CERT:cafile.pem}"
|
|
coap:
|
|
# If true coap command will be included in the list of all test commands using DEVICE_CONNECTIVITY_COAP_HOST and DEVICE_CONNECTIVITY_COAP_PORT.
|
|
enabled: "${DEVICE_CONNECTIVITY_COAP_ENABLED:true}"
|
|
# Host of coap transport service. If empty, the base URL host will be used.
|
|
host: "${DEVICE_CONNECTIVITY_COAP_HOST:}"
|
|
# Port of coap transport service. If empty, the default port for coap will be used.
|
|
port: "${DEVICE_CONNECTIVITY_COAP_PORT:5683}"
|
|
coaps:
|
|
# If true coap command will be included in the list of all test commands using DEVICE_CONNECTIVITY_COAPS_HOST and DEVICE_CONNECTIVITY_COAPS_PORT.
|
|
enabled: "${DEVICE_CONNECTIVITY_COAPS_ENABLED:false}"
|
|
# Host of coap transport service. If empty, the base URL host will be used.
|
|
host: "${DEVICE_CONNECTIVITY_COAPS_HOST:}"
|
|
# Port of coap transport service. If empty, the default port for coaps will be used.
|
|
port: "${DEVICE_CONNECTIVITY_COAPS_PORT:5684}"
|
|
# Path to the COAP CA root certificate file
|
|
pem_cert_file: "${DEVICE_CONNECTIVITY_COAPS_CA_ROOT_CERT:cafile.pem}"
|
|
gateway:
|
|
# The docker tag for thingsboard/tb-gateway image used in docker-compose file for gateway launch
|
|
image_version: "${DEVICE_CONNECTIVITY_GATEWAY_IMAGE_VERSION:3.8-stable}"
|
|
|
|
# Edges parameters
|
|
# Controls Edge instance gRPC communication, event storage, state persistence, and statistics reporting.
|
|
edges:
|
|
# Enable/disable Edge instance
|
|
enabled: "${EDGES_ENABLED:true}"
|
|
rpc:
|
|
# RPC port bind
|
|
port: "${EDGES_RPC_PORT:7070}"
|
|
# Specifies the minimum amount of time that should elapse between keepalive pings sent by the client
|
|
# This prevents clients from sending pings too frequently, which can be a nuisance to the server (potentially even a denial-of-service attack vector if abused)
|
|
# If a client sends pings more frequently than this interval, the server may terminate the connection.
|
|
client_max_keep_alive_time_sec: "${EDGES_RPC_CLIENT_MAX_KEEP_ALIVE_TIME_SEC:1}"
|
|
# Sets the time of inactivity (no read operations on the connection) after which the server will send a keepalive ping to the client.
|
|
# This is used to ensure that the connection is still alive and to prevent network intermediaries from dropping connections due to inactivity.
|
|
# It's a way for the server to proactively check if the client is still responsive.
|
|
keep_alive_time_sec: "${EDGES_RPC_KEEP_ALIVE_TIME_SEC:10}"
|
|
# Specifies the maximum amount of time the server waits for a response to its keepalive ping.
|
|
# If the ping is not acknowledged within this time frame, the server considers the connection dead and may close it.
|
|
# This timeout helps detect unresponsive clients.
|
|
keep_alive_timeout_sec: "${EDGES_RPC_KEEP_ALIVE_TIMEOUT_SEC:5}"
|
|
ssl:
|
|
# Enable/disable SSL support
|
|
enabled: "${EDGES_RPC_SSL_ENABLED:false}"
|
|
# Path to the server certificate file (holds server certificate or certificate chain, may include server private key).
|
|
# Accepts an absolute filesystem path (e.g. /etc/thingsboard/certChainFile.pem),
|
|
# a relative path resolved against the working directory first then the classpath,
|
|
# or a classpath resource with the explicit "classpath:" prefix (e.g. classpath:conf/certChainFile.pem).
|
|
cert: "${EDGES_RPC_SSL_CERT:certChainFile.pem}"
|
|
# Path to the server certificate private key file. Optional if the private key is already present in the cert file above.
|
|
# Supports the same path resolution as 'cert': absolute, relative/classpath, or "classpath:" prefix.
|
|
# Leave empty when using a combined PEM cert that already contains the private key.
|
|
private_key: "${EDGES_RPC_SSL_PRIVATE_KEY:privateKeyFile.pem}"
|
|
# Server certificate private key password (optional). Leave empty if the key is not encrypted.
|
|
key_password: "${EDGES_RPC_SSL_KEY_PASSWORD:}"
|
|
# Maximum size (in bytes) of inbound messages the cloud can handle from the edge. By default, it can handle messages up to 4 Megabytes
|
|
max_inbound_message_size: "${EDGES_RPC_MAX_INBOUND_MESSAGE_SIZE:4194304}"
|
|
# Maximum length of telemetry (time-series and attributes) message the cloud sends to the edge. By default, there is no limitation.
|
|
max_telemetry_message_size: "${EDGES_RPC_MAX_TELEMETRY_MESSAGE_SIZE:0}"
|
|
storage:
|
|
# Max records of edge event to read from DB and sent to the edge
|
|
max_read_records_count: "${EDGES_STORAGE_MAX_READ_RECORDS_COUNT:50}"
|
|
# Number of milliseconds to wait before the next check of edge events in DB
|
|
no_read_records_sleep: "${EDGES_NO_READ_RECORDS_SLEEP:1000}"
|
|
# Number of milliseconds to wait before resending failed batch of edge events to edge
|
|
sleep_between_batches: "${EDGES_SLEEP_BETWEEN_BATCHES:60000}"
|
|
# Time (in milliseconds) to subtract from the start timestamp when fetching edge events.
|
|
# This compensates for possible misordering between `created_time` (used for partitioning)
|
|
# and `seqId` (used for sorting). Without this, events with smaller seqId but larger created_time
|
|
# might be skipped, especially across partition boundaries.
|
|
misordering_compensation_millis: "${EDGES_MISORDERING_COMPENSATION_MILLIS:60000}"
|
|
# Max number of high priority edge events per edge session. No persistence - stored in memory
|
|
max_high_priority_queue_size_per_session: "${EDGES_MAX_HIGH_PRIORITY_QUEUE_SIZE_PER_SESSION:10000}"
|
|
# Number of threads that are used to check DB for edge events
|
|
scheduler_pool_size: "${EDGES_SCHEDULER_POOL_SIZE:4}"
|
|
# Number of threads that are used to send downlink messages to edge over gRPC
|
|
send_scheduler_pool_size: "${EDGES_SEND_SCHEDULER_POOL_SIZE:4}"
|
|
# Number of threads that are used to convert edge events from DB into downlink messages and send them for delivery
|
|
grpc_callback_thread_pool_size: "${EDGES_GRPC_CALLBACK_POOL_SIZE:4}"
|
|
state:
|
|
# Persist state of edge (active, last connect, last disconnect) into timeseries or attributes tables. 'false' means to store edge state into attributes table
|
|
persistToTelemetry: "${EDGES_PERSIST_STATE_TO_TELEMETRY:false}"
|
|
stats:
|
|
# Enable or disable reporting of edge communication stats (true or false)
|
|
enabled: "${EDGES_STATS_ENABLED:true}"
|
|
# Time-to-live in days for stored edge communication stats in timeseries
|
|
ttl: "${EDGES_STATS_TTL:30}"
|
|
# How often to report edge communication stats in milliseconds
|
|
report-interval-millis: "${EDGES_STATS_REPORT_INTERVAL_MS:600000}"
|
|
|
|
# Spring doc common parameters
|
|
# Enables or disables the OpenAPI/Swagger documentation endpoint and sets the default media type.
|
|
springdoc:
|
|
# If false swagger API docs will be unavailable
|
|
api-docs.enabled: "${SWAGGER_ENABLED:true}"
|
|
# Swagger default produces media-type
|
|
default-produces-media-type: "${SWAGGER_DEFAULT_PRODUCES_MEDIA_TYPE:application/json}"
|
|
|
|
# Swagger common parameters
|
|
# Configures Swagger UI metadata: title, description, contact, license, version, and API path patterns.
|
|
swagger:
|
|
# General swagger match pattern of swagger UI links
|
|
api_path: "${SWAGGER_API_PATH:/api/**}"
|
|
# General swagger match pattern path of swagger UI links
|
|
security_path_regex: "${SWAGGER_SECURITY_PATH_REGEX:/api/.*}"
|
|
# Nonsecurity API path match pattern of swagger UI links
|
|
non_security_path_regex: "${SWAGGER_NON_SECURITY_PATH_REGEX:/api/(?:noauth|v1)/.*}"
|
|
# The title on the API doc UI page
|
|
title: "${SWAGGER_TITLE:ThingsBoard REST API}"
|
|
# The description on the API doc UI page
|
|
description: "${SWAGGER_DESCRIPTION: ThingsBoard open-source IoT platform REST API documentation.}"
|
|
contact:
|
|
# The contact name on the API doc UI page
|
|
name: "${SWAGGER_CONTACT_NAME:ThingsBoard team}"
|
|
# The contact URL on the API doc UI page
|
|
url: "${SWAGGER_CONTACT_URL:https://thingsboard.io}"
|
|
# The contact email on the API doc UI page
|
|
email: "${SWAGGER_CONTACT_EMAIL:info@thingsboard.io}"
|
|
license:
|
|
# The license title on the API doc UI page
|
|
title: "${SWAGGER_LICENSE_TITLE:Apache License Version 2.0}"
|
|
# Link to the license body on the API doc UI page
|
|
url: "${SWAGGER_LICENSE_URL:https://github.com/thingsboard/thingsboard/blob/master/LICENSE}"
|
|
# The version of the API doc to display. Default to the package version.
|
|
version: "${SWAGGER_VERSION:}"
|
|
# The group name (definition) on the API doc UI page.
|
|
group_name: "${SWAGGER_GROUP_NAME:thingsboard}"
|
|
# Control the initial display state of API operations and tags (none or list)
|
|
doc_expansion: "${SWAGGER_DOC_EXPANSION:list}"
|
|
|
|
# Queue configuration parameters
|
|
# Configures the message queue backend (in-memory or Kafka) and all topic/partition/consumer settings for each service.
|
|
queue:
|
|
type: "${TB_QUEUE_TYPE:in-memory}" # in-memory or kafka (Apache Kafka)
|
|
prefix: "${TB_QUEUE_PREFIX:}" # Global queue prefix. If specified, prefix is added before default topic name: 'prefix.default_topic_name'. Prefix is applied to all topics (and consumer groups for kafka).
|
|
in_memory:
|
|
stats:
|
|
# For debug level
|
|
print-interval-ms: "${TB_QUEUE_IN_MEMORY_STATS_PRINT_INTERVAL_MS:60000}"
|
|
kafka:
|
|
# Kafka Bootstrap nodes in "host:port" format
|
|
bootstrap.servers: "${TB_KAFKA_SERVERS:localhost:9092}"
|
|
ssl:
|
|
# Enable/Disable SSL Kafka communication
|
|
enabled: "${TB_KAFKA_SSL_ENABLED:false}"
|
|
# The location of the trust store file
|
|
truststore.location: "${TB_KAFKA_SSL_TRUSTSTORE_LOCATION:}"
|
|
# The password of trust store file if specified
|
|
truststore.password: "${TB_KAFKA_SSL_TRUSTSTORE_PASSWORD:}"
|
|
# The location of the key store file. This is optional for the client and can be used for two-way authentication for the client
|
|
keystore.location: "${TB_KAFKA_SSL_KEYSTORE_LOCATION:}"
|
|
# The store password for the key store file. This is optional for the client and only needed if ‘ssl.keystore.location’ is configured. Key store password is not supported for PEM format
|
|
keystore.password: "${TB_KAFKA_SSL_KEYSTORE_PASSWORD:}"
|
|
# The password of the private key in the key store file or the PEM key specified in ‘keystore.key’
|
|
key.password: "${TB_KAFKA_SSL_KEY_PASSWORD:}"
|
|
# The number of acknowledgments the producer requires the leader to have received before considering a request complete. This controls the durability of records that are sent. The following settings are allowed:0, 1 and all
|
|
acks: "${TB_KAFKA_ACKS:all}"
|
|
# Number of retries. Resend any record whose send fails with a potentially transient error
|
|
retries: "${TB_KAFKA_RETRIES:1}"
|
|
# The compression type for all data generated by the producer. The default is none (i.e. no compression). Valid values none or gzip
|
|
compression.type: "${TB_KAFKA_COMPRESSION_TYPE:none}" # none or gzip
|
|
# Default batch size. This setting gives the upper bound of the batch size to be sent
|
|
batch.size: "${TB_KAFKA_BATCH_SIZE:16384}"
|
|
# This variable creates a small amount of artificial delay—that is, rather than immediately sending out a record
|
|
linger.ms: "${TB_KAFKA_LINGER_MS:1}"
|
|
# The maximum size of a request in bytes. This setting will limit the number of record batches the producer will send in a single request to avoid sending huge requests
|
|
max.request.size: "${TB_KAFKA_MAX_REQUEST_SIZE:1048576}"
|
|
# The maximum number of unacknowledged requests the client will send on a single connection before blocking
|
|
max.in.flight.requests.per.connection: "${TB_KAFKA_MAX_IN_FLIGHT_REQUESTS_PER_CONNECTION:5}"
|
|
# The total bytes of memory the producer can use to buffer records waiting to be sent to the server
|
|
buffer.memory: "${TB_BUFFER_MEMORY:33554432}"
|
|
# The multiple copies of data over the multiple brokers of Kafka
|
|
replication_factor: "${TB_QUEUE_KAFKA_REPLICATION_FACTOR:1}"
|
|
# The maximum delay between invocations of poll() method when using consumer group management. This places an upper bound on the amount of time that the consumer can be idle before fetching more records
|
|
max_poll_interval_ms: "${TB_QUEUE_KAFKA_MAX_POLL_INTERVAL_MS:300000}"
|
|
# The maximum number of records returned in a single call of poll() method
|
|
max_poll_records: "${TB_QUEUE_KAFKA_MAX_POLL_RECORDS:8192}"
|
|
# The maximum amount of data per-partition the server will return. Records are fetched in batches by the consumer
|
|
max_partition_fetch_bytes: "${TB_QUEUE_KAFKA_MAX_PARTITION_FETCH_BYTES:16777216}"
|
|
# The maximum amount of data the server will return. Records are fetched in batches by the consumer
|
|
fetch_max_bytes: "${TB_QUEUE_KAFKA_FETCH_MAX_BYTES:134217728}"
|
|
request.timeout.ms: "${TB_QUEUE_KAFKA_REQUEST_TIMEOUT_MS:30000}" # (30 seconds) # refer to https://docs.confluent.io/platform/current/installation/configuration/producer-configs.html#producerconfigs_request.timeout.ms
|
|
session.timeout.ms: "${TB_QUEUE_KAFKA_SESSION_TIMEOUT_MS:10000}" # (10 seconds) # refer to https://docs.confluent.io/platform/current/installation/configuration/consumer-configs.html#consumerconfigs_session.timeout.ms
|
|
auto_offset_reset: "${TB_QUEUE_KAFKA_AUTO_OFFSET_RESET:earliest}" # earliest, latest or none
|
|
# Enable/Disable using of Confluent Cloud
|
|
use_confluent_cloud: "${TB_QUEUE_KAFKA_USE_CONFLUENT_CLOUD:false}"
|
|
confluent:
|
|
# The endpoint identification algorithm used by clients to validate server hostname. The default value is https
|
|
ssl.algorithm: "${TB_QUEUE_KAFKA_CONFLUENT_SSL_ALGORITHM:https}"
|
|
# The mechanism used to authenticate Schema Registry requests. SASL/PLAIN should only be used with TLS/SSL as a transport layer to ensure that clear passwords are not transmitted on the wire without encryption
|
|
sasl.mechanism: "${TB_QUEUE_KAFKA_CONFLUENT_SASL_MECHANISM:PLAIN}"
|
|
# Using JAAS Configuration for specifying multiple SASL mechanisms on a broker
|
|
sasl.config: "${TB_QUEUE_KAFKA_CONFLUENT_SASL_JAAS_CONFIG:org.apache.kafka.common.security.plain.PlainLoginModule required username=\"CLUSTER_API_KEY\" password=\"CLUSTER_API_SECRET\";}"
|
|
# Protocol used to communicate with brokers. Valid values are: PLAINTEXT, SSL, SASL_PLAINTEXT, SASL_SSL
|
|
security.protocol: "${TB_QUEUE_KAFKA_CONFLUENT_SECURITY_PROTOCOL:SASL_SSL}"
|
|
# Key-value properties for Kafka consumer per specific topic, e.g. tb_ota_package is a topic name for ota, tb_rule_engine.sq is a topic name for default SequentialByOriginator queue.
|
|
# Check TB_QUEUE_CORE_OTA_TOPIC and TB_QUEUE_RE_SQ_TOPIC params
|
|
consumer-properties-per-topic:
|
|
tb_ota_package:
|
|
# Key-value properties for Kafka consumer per specific topic, e.g. tb_ota_package is a topic name for ota, tb_rule_engine.sq is a topic name for default SequentialByOriginator queue. Check TB_QUEUE_CORE_OTA_TOPIC and TB_QUEUE_RE_SQ_TOPIC params
|
|
- key: max.poll.records
|
|
# Example of specific consumer properties value per topic
|
|
value: "${TB_QUEUE_KAFKA_OTA_MAX_POLL_RECORDS:10}"
|
|
tb_version_control:
|
|
# Example of specific consumer properties value per topic for VC
|
|
- key: max.poll.interval.ms
|
|
# Example of specific consumer properties value per topic for VC
|
|
value: "${TB_QUEUE_KAFKA_VC_MAX_POLL_INTERVAL_MS:600000}"
|
|
# tb_rule_engine.sq:
|
|
# - key: max.poll.records
|
|
# value: "${TB_QUEUE_KAFKA_SQ_MAX_POLL_RECORDS:1024}"
|
|
tb_edge:
|
|
# Properties for consumers targeting edge service update topics.
|
|
- key: max.poll.records
|
|
# Define the maximum number of records that can be polled from tb_edge topics per request.
|
|
value: "${TB_QUEUE_KAFKA_EDGE_EVENTS_MAX_POLL_RECORDS:10}"
|
|
tb_edge.notifications:
|
|
# Properties for consumers targeting high-priority edge notifications.
|
|
# These notifications include RPC calls, lifecycle events, and new queue messages,
|
|
# requiring minimal latency and swift processing.
|
|
- key: max.poll.records
|
|
# Define the maximum number of records that can be polled from tb_edge.notifications.SERVICE_ID topics.
|
|
value: "${TB_QUEUE_KAFKA_EDGE_HP_EVENTS_MAX_POLL_RECORDS:10}"
|
|
tb_edge_event.notifications:
|
|
# Properties for consumers targeting downlinks meant for specific edge topics.
|
|
# Topic names are dynamically constructed using tenant and edge identifiers.
|
|
- key: max.poll.records
|
|
# Define the maximum number of records that can be polled from tb_edge_event.notifications.TENANT_ID.EDGE_ID topics.
|
|
value: "${TB_QUEUE_KAFKA_EDGE_NOTIFICATIONS_MAX_POLL_RECORDS:10}"
|
|
tb_housekeeper:
|
|
# Consumer properties for Housekeeper tasks topic
|
|
- key: max.poll.records
|
|
# Amount of records to be returned in a single poll. For Housekeeper tasks topic, we should consume messages (tasks) one by one
|
|
value: "${TB_QUEUE_KAFKA_HOUSEKEEPER_MAX_POLL_RECORDS:1}"
|
|
tb_housekeeper.reprocessing:
|
|
# Consumer properties for Housekeeper reprocessing topic
|
|
- key: max.poll.records
|
|
# Amount of records to be returned in a single poll. For Housekeeper reprocessing topic, we should consume messages (tasks) one by one
|
|
value: "${TB_QUEUE_KAFKA_HOUSEKEEPER_REPROCESSING_MAX_POLL_RECORDS:1}"
|
|
edqs.events:
|
|
# Key-value properties for Kafka consumer for edqs.events topic
|
|
- key: max.poll.records
|
|
# Max poll records for edqs.events topic
|
|
value: "${TB_QUEUE_KAFKA_EDQS_EVENTS_MAX_POLL_RECORDS:512}"
|
|
edqs.state:
|
|
# Key-value properties for Kafka consumer for edqs.state topic
|
|
- key: max.poll.records
|
|
# Max poll records for edqs.state topic
|
|
value: "${TB_QUEUE_KAFKA_EDQS_STATE_MAX_POLL_RECORDS:512}"
|
|
tasks:
|
|
# Key-value properties for Kafka consumer for tasks topics
|
|
- key: max.poll.records
|
|
# Max poll records for tasks topics
|
|
value: "${TB_QUEUE_KAFKA_TASKS_MAX_POLL_RECORDS:1}"
|
|
# If you override any default Kafka topic name using environment variables, you must also specify the related consumer properties
|
|
# for the new topic in `consumer-properties-per-topic-inline`. Otherwise, the topic will not inherit its expected configuration (e.g., max.poll.records, timeouts, etc).
|
|
# Each entry sets a single property for a specific topic. To define multiple properties for a topic, repeat the topic key.
|
|
# Format: "topic1:key=value;topic1:key=value;topic2:key=value"
|
|
# Example: tb_core_updated:max.poll.records=10;tb_core_updated:bootstrap.servers=kafka1:9092,kafka2:9092;tb_edge_updated:auto.offset.reset=latest
|
|
consumer-properties-per-topic-inline: "${TB_QUEUE_KAFKA_CONSUMER_PROPERTIES_PER_TOPIC_INLINE:}"
|
|
other-inline: "${TB_QUEUE_KAFKA_OTHER_PROPERTIES:}" # In this section you can specify custom parameters (semicolon separated) for Kafka consumer/producer/admin # Example "metrics.recording.level:INFO;metrics.sample.window.ms:30000"
|
|
other: # DEPRECATED. In this section, you can specify custom parameters for Kafka consumer/producer and expose the env variables to configure outside
|
|
# - key: "request.timeout.ms" # refer to https://docs.confluent.io/platform/current/installation/configuration/producer-configs.html#producerconfigs_request.timeout.ms
|
|
# value: "${TB_QUEUE_KAFKA_REQUEST_TIMEOUT_MS:30000}" # (30 seconds)
|
|
# - key: "session.timeout.ms" # refer to https://docs.confluent.io/platform/current/installation/configuration/consumer-configs.html#consumerconfigs_session.timeout.ms
|
|
# value: "${TB_QUEUE_KAFKA_SESSION_TIMEOUT_MS:10000}" # (10 seconds)
|
|
topic-properties:
|
|
# Kafka properties for Rule Engine
|
|
rule-engine: "${TB_QUEUE_KAFKA_RE_TOPIC_PROPERTIES:retention.ms:604800000;segment.bytes:52428800;retention.bytes:1048576000;partitions:1;min.insync.replicas:1}"
|
|
# Kafka properties for Core topics
|
|
core: "${TB_QUEUE_KAFKA_CORE_TOPIC_PROPERTIES:retention.ms:604800000;segment.bytes:52428800;retention.bytes:1048576000;partitions:1;min.insync.replicas:1}"
|
|
# Kafka properties for Transport Api topics
|
|
transport-api: "${TB_QUEUE_KAFKA_TA_TOPIC_PROPERTIES:retention.ms:604800000;segment.bytes:52428800;retention.bytes:1048576000;partitions:10;min.insync.replicas:1}"
|
|
# Kafka properties for Notifications topics
|
|
notifications: "${TB_QUEUE_KAFKA_NOTIFICATIONS_TOPIC_PROPERTIES:retention.ms:604800000;segment.bytes:52428800;retention.bytes:1048576000;partitions:1;min.insync.replicas:1}"
|
|
# Kafka properties for JS Executor topics
|
|
js-executor: "${TB_QUEUE_KAFKA_JE_TOPIC_PROPERTIES:retention.ms:86400000;segment.bytes:52428800;retention.bytes:104857600;partitions:30;min.insync.replicas:1}"
|
|
# Kafka properties for OTA updates topic
|
|
ota-updates: "${TB_QUEUE_KAFKA_OTA_TOPIC_PROPERTIES:retention.ms:604800000;segment.bytes:52428800;retention.bytes:1048576000;partitions:10;min.insync.replicas:1}"
|
|
# Kafka properties for Version Control topic
|
|
version-control: "${TB_QUEUE_KAFKA_VC_TOPIC_PROPERTIES:retention.ms:604800000;segment.bytes:52428800;retention.bytes:1048576000;partitions:1;min.insync.replicas:1}"
|
|
# Kafka properties for Housekeeper tasks topic
|
|
housekeeper: "${TB_QUEUE_KAFKA_HOUSEKEEPER_TOPIC_PROPERTIES:retention.ms:604800000;segment.bytes:52428800;retention.bytes:1048576000;partitions:10;min.insync.replicas:1}"
|
|
# Kafka properties for Housekeeper reprocessing topic; retention.ms is set to 90 days; partitions is set to 1 since only one reprocessing service is running at a time
|
|
housekeeper-reprocessing: "${TB_QUEUE_KAFKA_HOUSEKEEPER_REPROCESSING_TOPIC_PROPERTIES:retention.ms:7776000000;segment.bytes:52428800;retention.bytes:1048576000;partitions:1;min.insync.replicas:1}"
|
|
# Kafka properties for Edge topic
|
|
edge: "${TB_QUEUE_KAFKA_EDGE_TOPIC_PROPERTIES:retention.ms:604800000;segment.bytes:52428800;retention.bytes:1048576000;partitions:1;min.insync.replicas:1}"
|
|
# Kafka properties for Edge event topic
|
|
edge-event: "${TB_QUEUE_KAFKA_EDGE_EVENT_TOPIC_PROPERTIES:retention.ms:2592000000;segment.bytes:52428800;retention.bytes:1048576000;partitions:1;min.insync.replicas:1}"
|
|
# Kafka properties for Calculated Field topics
|
|
calculated-field: "${TB_QUEUE_KAFKA_CF_TOPIC_PROPERTIES:retention.ms:604800000;segment.bytes:52428800;retention.bytes:1048576000;partitions:1;min.insync.replicas:1}"
|
|
# Kafka properties for Calculated Field State topics
|
|
calculated-field-state: "${TB_QUEUE_KAFKA_CF_STATE_TOPIC_PROPERTIES:retention.ms:-1;segment.bytes:52428800;retention.bytes:104857600000;partitions:1;min.insync.replicas:1;cleanup.policy:compact}"
|
|
# Kafka properties for EDQS events topics
|
|
edqs-events: "${TB_QUEUE_KAFKA_EDQS_EVENTS_TOPIC_PROPERTIES:retention.ms:86400000;segment.bytes:52428800;retention.bytes:-1;partitions:1;min.insync.replicas:1}"
|
|
# Kafka properties for EDQS requests topic (default: 3 minutes retention)
|
|
edqs-requests: "${TB_QUEUE_KAFKA_EDQS_REQUESTS_TOPIC_PROPERTIES:retention.ms:180000;segment.bytes:52428800;retention.bytes:1048576000;partitions:1;min.insync.replicas:1}"
|
|
# Kafka properties for EDQS state topic (infinite retention, compaction)
|
|
edqs-state: "${TB_QUEUE_KAFKA_EDQS_STATE_TOPIC_PROPERTIES:retention.ms:-1;segment.bytes:52428800;retention.bytes:-1;partitions:1;min.insync.replicas:1;cleanup.policy:compact}"
|
|
# Kafka properties for tasks topics
|
|
tasks: "${TB_QUEUE_KAFKA_TASKS_TOPIC_PROPERTIES:retention.ms:604800000;segment.bytes:52428800;retention.bytes:104857600;partitions:1;min.insync.replicas:1}"
|
|
consumer-stats:
|
|
# Prints lag between consumer group offset and last messages offset in Kafka topics
|
|
enabled: "${TB_QUEUE_KAFKA_CONSUMER_STATS_ENABLED:true}"
|
|
# Statistics printing interval for Kafka's consumer-groups stats
|
|
print-interval-ms: "${TB_QUEUE_KAFKA_CONSUMER_STATS_MIN_PRINT_INTERVAL_MS:60000}"
|
|
# Time to wait for the stats-loading requests to Kafka to finish
|
|
kafka-response-timeout-ms: "${TB_QUEUE_KAFKA_CONSUMER_STATS_RESPONSE_TIMEOUT_MS:1000}"
|
|
# Topics cache TTL in milliseconds. 5 minutes by default
|
|
topics_cache_ttl_ms: "${TB_QUEUE_KAFKA_TOPICS_CACHE_TTL_MS:300000}"
|
|
partitions:
|
|
hash_function_name: "${TB_QUEUE_PARTITIONS_HASH_FUNCTION_NAME:murmur3_128}" # murmur3_32, murmur3_128 or sha256
|
|
transport_api:
|
|
# Topic used to consume api requests from transport microservices
|
|
requests_topic: "${TB_QUEUE_TRANSPORT_API_REQUEST_TOPIC:tb_transport.api.requests}"
|
|
# Topic used to produce api responses to transport microservices
|
|
responses_topic: "${TB_QUEUE_TRANSPORT_API_RESPONSE_TOPIC:tb_transport.api.responses}"
|
|
# Maximum pending api requests from transport microservices to be handled by server
|
|
max_pending_requests: "${TB_QUEUE_TRANSPORT_MAX_PENDING_REQUESTS:10000}"
|
|
# Maximum timeout in milliseconds to handle api request from transport microservice by server
|
|
max_requests_timeout: "${TB_QUEUE_TRANSPORT_MAX_REQUEST_TIMEOUT:10000}"
|
|
# Amount of threads used to invoke callbacks
|
|
max_callback_threads: "${TB_QUEUE_TRANSPORT_MAX_CALLBACK_THREADS:100}"
|
|
# Amount of threads used for transport API requests
|
|
max_core_handler_threads: "${TB_QUEUE_TRANSPORT_MAX_CORE_HANDLER_THREADS:16}"
|
|
# Interval in milliseconds to poll api requests from transport microservices
|
|
request_poll_interval: "${TB_QUEUE_TRANSPORT_REQUEST_POLL_INTERVAL_MS:25}"
|
|
# Interval in milliseconds to poll api response from transport microservices
|
|
response_poll_interval: "${TB_QUEUE_TRANSPORT_RESPONSE_POLL_INTERVAL_MS:25}"
|
|
core:
|
|
# Default topic name
|
|
topic: "${TB_QUEUE_CORE_TOPIC:tb_core}"
|
|
# For high-priority notifications that require minimum latency and processing time
|
|
notifications_topic: "${TB_QUEUE_CORE_NOTIFICATIONS_TOPIC:tb_core.notifications}"
|
|
# Interval in milliseconds to poll messages by Core microservices
|
|
poll-interval: "${TB_QUEUE_CORE_POLL_INTERVAL_MS:25}"
|
|
# Amount of partitions used by Core microservices
|
|
partitions: "${TB_QUEUE_CORE_PARTITIONS:10}"
|
|
# Timeout for processing a message pack by Core microservices
|
|
pack-processing-timeout: "${TB_QUEUE_CORE_PACK_PROCESSING_TIMEOUT_MS:2000}"
|
|
# Enable/disable a separate consumer per partition for Core queue
|
|
consumer-per-partition: "${TB_QUEUE_CORE_CONSUMER_PER_PARTITION:true}"
|
|
ota:
|
|
# Default topic name for OTA updates
|
|
topic: "${TB_QUEUE_CORE_OTA_TOPIC:tb_ota_package}"
|
|
# The interval of processing the OTA updates for devices. Used to avoid any harm to the network due to many parallel OTA updates
|
|
pack-interval-ms: "${TB_QUEUE_CORE_OTA_PACK_INTERVAL_MS:60000}"
|
|
# The size of OTA updates notifications fetched from the queue. The queue stores pairs of firmware and device ids
|
|
pack-size: "${TB_QUEUE_CORE_OTA_PACK_SIZE:100}"
|
|
# Stats topic name
|
|
usage-stats-topic: "${TB_QUEUE_US_TOPIC:tb_usage_stats}"
|
|
stats:
|
|
# Enable/disable statistics for Core microservices
|
|
enabled: "${TB_QUEUE_CORE_STATS_ENABLED:true}"
|
|
# Statistics printing interval for Core microservices
|
|
print-interval-ms: "${TB_QUEUE_CORE_STATS_PRINT_INTERVAL_MS:60000}"
|
|
housekeeper:
|
|
# Topic name for Housekeeper tasks
|
|
topic: "${TB_HOUSEKEEPER_TOPIC:tb_housekeeper}"
|
|
# Topic name for Housekeeper tasks to be reprocessed
|
|
reprocessing-topic: "${TB_HOUSEKEEPER_REPROCESSING_TOPIC:tb_housekeeper.reprocessing}"
|
|
# Poll interval for topics related to Housekeeper
|
|
poll-interval-ms: "${TB_HOUSEKEEPER_POLL_INTERVAL_MS:500}"
|
|
# Timeout in milliseconds for task processing. Tasks that fail to finish on time will be submitted for reprocessing
|
|
task-processing-timeout-ms: "${TB_HOUSEKEEPER_TASK_PROCESSING_TIMEOUT_MS:120000}"
|
|
# Comma-separated list of task types that shouldn't be processed. Available task types:
|
|
# DELETE_ATTRIBUTES, DELETE_TELEMETRY (both DELETE_LATEST_TS and DELETE_TS_HISTORY will be disabled),
|
|
# DELETE_LATEST_TS, DELETE_TS_HISTORY, DELETE_EVENTS, DELETE_ALARMS, UNASSIGN_ALARMS
|
|
disabled-task-types: "${TB_HOUSEKEEPER_DISABLED_TASK_TYPES:}"
|
|
# Delay in milliseconds between tasks reprocessing
|
|
task-reprocessing-delay-ms: "${TB_HOUSEKEEPER_TASK_REPROCESSING_DELAY_MS:3000}"
|
|
# Maximum amount of task reprocessing attempts. After exceeding, the task will be dropped
|
|
max-reprocessing-attempts: "${TB_HOUSEKEEPER_MAX_REPROCESSING_ATTEMPTS:10}"
|
|
stats:
|
|
# Enable/disable statistics for Housekeeper
|
|
enabled: "${TB_HOUSEKEEPER_STATS_ENABLED:true}"
|
|
# Statistics printing interval for Housekeeper
|
|
print-interval-ms: "${TB_HOUSEKEEPER_STATS_PRINT_INTERVAL_MS:60000}"
|
|
edqs:
|
|
sync:
|
|
# Enable/disable EDQS synchronization
|
|
enabled: "${TB_EDQS_SYNC_ENABLED:false}"
|
|
# Batch size of entities being synced with EDQS
|
|
entity_batch_size: "${TB_EDQS_SYNC_ENTITY_BATCH_SIZE:10000}"
|
|
# Batch size of timeseries data being synced with EDQS
|
|
ts_batch_size: "${TB_EDQS_SYNC_TS_BATCH_SIZE:10000}"
|
|
api:
|
|
# Whether to forward entity data query requests to EDQS (otherwise use PostgreSQL implementation)
|
|
supported: "${TB_EDQS_API_SUPPORTED:false}"
|
|
# Whether to auto-enable EDQS API (if queue.edqs.api.supported is true) when sync of data to Kafka is finished
|
|
auto_enable: "${TB_EDQS_API_AUTO_ENABLE:true}"
|
|
# Interval in milliseconds to check for ready EDQS servers
|
|
readiness_check_interval: "${TB_EDQS_READINESS_CHECK_INTERVAL_MS:60000}"
|
|
# Mode of EDQS: local (for monolith) or remote (with separate EDQS microservices)
|
|
mode: "${TB_EDQS_MODE:local}"
|
|
local:
|
|
# Path to RocksDB for EDQS backup when running in local mode
|
|
rocksdb_path: "${TB_EDQS_ROCKSDB_PATH:${user.home}/.rocksdb/edqs}"
|
|
# Number of partitions for EDQS topics
|
|
partitions: "${TB_EDQS_PARTITIONS:12}"
|
|
# EDQS partitioning strategy: tenant (partition is resolved by tenant id) or none (no specific strategy, resolving by message key)
|
|
partitioning_strategy: "${TB_EDQS_PARTITIONING_STRATEGY:tenant}"
|
|
# EDQS events topic
|
|
events_topic: "${TB_EDQS_EVENTS_TOPIC:edqs.events}"
|
|
# EDQS state topic
|
|
state_topic: "${TB_EDQS_STATE_TOPIC:edqs.state}"
|
|
# EDQS requests topic
|
|
requests_topic: "${TB_EDQS_REQUESTS_TOPIC:edqs.requests}"
|
|
# EDQS responses topic
|
|
responses_topic: "${TB_EDQS_RESPONSES_TOPIC:edqs.responses}"
|
|
# Poll interval for EDQS topics
|
|
poll_interval: "${TB_EDQS_POLL_INTERVAL_MS:25}"
|
|
# Maximum amount of pending requests to EDQS
|
|
max_pending_requests: "${TB_EDQS_MAX_PENDING_REQUESTS:10000}"
|
|
# Maximum timeout for requests to EDQS
|
|
max_request_timeout: "${TB_EDQS_MAX_REQUEST_TIMEOUT:20000}"
|
|
# Thread pool size for EDQS requests executor
|
|
request_executor_size: "${TB_EDQS_REQUEST_EXECUTOR_SIZE:50}"
|
|
# Time to live for EDQS versions cache in minutes. Must be bigger than the time taken for the sync process.
|
|
versions_cache_ttl: "${TB_EDQS_VERSIONS_CACHE_TTL_MINUTES:60}"
|
|
# Strings longer than this threshold will be compressed
|
|
string_compression_length_threshold: "${TB_EDQS_STRING_COMPRESSION_LENGTH_THRESHOLD:512}"
|
|
stats:
|
|
# Enable/disable statistics for EDQS
|
|
enabled: "${TB_EDQS_STATS_ENABLED:true}"
|
|
# Threshold for slow queries to log, in milliseconds
|
|
slow_query_threshold: "${TB_EDQS_SLOW_QUERY_THRESHOLD_MS:3000}"
|
|
vc:
|
|
# Default topic name
|
|
topic: "${TB_QUEUE_VC_TOPIC:tb_version_control}"
|
|
# Number of partitions to associate with this queue. Used for scaling the number of messages that can be processed in parallel
|
|
partitions: "${TB_QUEUE_VC_PARTITIONS:10}"
|
|
# Interval in milliseconds between polling of the messages if no new messages arrive
|
|
poll-interval: "${TB_QUEUE_VC_INTERVAL_MS:25}"
|
|
# Timeout before retrying all failed and timed-out messages from the processing pack
|
|
pack-processing-timeout: "${TB_QUEUE_VC_PACK_PROCESSING_TIMEOUT_MS:180000}"
|
|
# Timeout for a request to VC-executor (for a request for the version of the entity, for a commit charge, etc.)
|
|
request-timeout: "${TB_QUEUE_VC_REQUEST_TIMEOUT:180000}"
|
|
# Limit for single queue message size
|
|
msg-chunk-size: "${TB_QUEUE_VC_MSG_CHUNK_SIZE:250000}"
|
|
js:
|
|
# JS Eval request topic
|
|
request_topic: "${REMOTE_JS_EVAL_REQUEST_TOPIC:js_eval.requests}"
|
|
# JS Eval responses topic prefix that is combined with node id
|
|
response_topic_prefix: "${REMOTE_JS_EVAL_RESPONSE_TOPIC:js_eval.responses}"
|
|
# JS Eval max pending requests
|
|
max_pending_requests: "${REMOTE_JS_MAX_PENDING_REQUESTS:10000}"
|
|
# JS Eval max request timeout
|
|
max_eval_requests_timeout: "${REMOTE_JS_MAX_EVAL_REQUEST_TIMEOUT:60000}"
|
|
# JS max request timeout
|
|
max_requests_timeout: "${REMOTE_JS_MAX_REQUEST_TIMEOUT:10000}"
|
|
# JS execution max request timeout
|
|
max_exec_requests_timeout: "${REMOTE_JS_MAX_EXEC_REQUEST_TIMEOUT:2000}"
|
|
# JS response poll interval
|
|
response_poll_interval: "${REMOTE_JS_RESPONSE_POLL_INTERVAL_MS:25}"
|
|
rule-engine:
|
|
# Deprecated. It will be removed in the nearest releases
|
|
topic: "${TB_QUEUE_RULE_ENGINE_TOPIC:tb_rule_engine}"
|
|
# For high-priority notifications that require minimum latency and processing time
|
|
notifications_topic: "${TB_QUEUE_RULE_ENGINE_NOTIFICATIONS_TOPIC:tb_rule_engine.notifications}"
|
|
# Interval in milliseconds to poll messages by Rule Engine
|
|
poll-interval: "${TB_QUEUE_RULE_ENGINE_POLL_INTERVAL_MS:25}"
|
|
# Timeout for processing a message pack of Rule Engine
|
|
pack-processing-timeout: "${TB_QUEUE_RULE_ENGINE_PACK_PROCESSING_TIMEOUT_MS:2000}"
|
|
stats:
|
|
# Enable/disable statistics for Rule Engine
|
|
enabled: "${TB_QUEUE_RULE_ENGINE_STATS_ENABLED:true}"
|
|
# Statistics printing interval for Rule Engine
|
|
print-interval-ms: "${TB_QUEUE_RULE_ENGINE_STATS_PRINT_INTERVAL_MS:60000}"
|
|
# Max length of the error message that is printed by statistics
|
|
max-error-message-length: "${TB_QUEUE_RULE_ENGINE_MAX_ERROR_MESSAGE_LENGTH:4096}"
|
|
prometheus-stats:
|
|
# Enable/disable Prometheus statistics for individual Rule Engine message processing (records time in ms for success/failure).
|
|
enabled: "${TB_QUEUE_RULE_ENGINE_PROMETHEUS_STATS_ENABLED:false}"
|
|
# After a queue is deleted (or the profile's isolation option was disabled), Rule Engine will continue reading related topics during this period before deleting the actual topics
|
|
topic-deletion-delay: "${TB_QUEUE_RULE_ENGINE_TOPIC_DELETION_DELAY_SEC:15}"
|
|
# Size of the thread pool that handles such operations as partition changes, config updates, queue deletion
|
|
management-thread-pool-size: "${TB_QUEUE_RULE_ENGINE_MGMT_THREAD_POOL_SIZE:12}"
|
|
calculated_fields:
|
|
# Topic name for Calculated Field (CF) events from Rule Engine
|
|
event_topic: "${TB_QUEUE_CF_EVENT_TOPIC:tb_cf_event}"
|
|
# Topic name for Calculated Field (CF) compacted states
|
|
state_topic: "${TB_QUEUE_CF_STATE_TOPIC:tb_cf_state}"
|
|
# For high-priority notifications that require minimum latency and processing time
|
|
notifications_topic: "${TB_QUEUE_CF_NOTIFICATIONS_TOPIC:calculated_field.notifications}"
|
|
# Interval in milliseconds to poll messages by CF (Rule Engine) microservices
|
|
poll_interval: "${TB_QUEUE_CF_POLL_INTERVAL_MS:1000}"
|
|
# Timeout for processing a message pack by CF microservices
|
|
pack_processing_timeout: "${TB_QUEUE_CF_PACK_PROCESSING_TIMEOUT_MS:60000}"
|
|
# Thread pool size for processing of the incoming messages
|
|
pool_size: "${TB_QUEUE_CF_POOL_SIZE:8}"
|
|
# RocksDB path for storing CF states
|
|
rocks_db_path: "${TB_QUEUE_CF_ROCKS_DB_PATH:${user.home}/.rocksdb/cf_states}"
|
|
# The fetch size specifies how many rows will be fetched from the database per request for initial fetching
|
|
init_fetch_pack_size: "${TB_QUEUE_CF_FETCH_PACK_SIZE:50000}"
|
|
# The fetch size specifies how many rows will be fetched from the database per request for per-tenant fetching
|
|
init_tenant_fetch_pack_size: "${TB_QUEUE_CF_TENANT_FETCH_PACK_SIZE:1000}"
|
|
transport:
|
|
# For high-priority notifications that require minimum latency and processing time
|
|
notifications_topic: "${TB_QUEUE_TRANSPORT_NOTIFICATIONS_TOPIC:tb_transport.notifications}"
|
|
# Interval in milliseconds to poll messages
|
|
poll_interval: "${TB_QUEUE_TRANSPORT_NOTIFICATIONS_POLL_INTERVAL_MS:25}"
|
|
edge:
|
|
# Topic name to notify edge service on entity updates, assignment, etc.
|
|
topic: "${TB_QUEUE_EDGE_TOPIC:tb_edge}"
|
|
# Topic prefix for high-priority edge notifications (rpc, lifecycle, new messages in queue) that require minimum latency and processing time.
|
|
# Each tb-core has its own topic: PREFIX.SERVICE_ID
|
|
notifications_topic: "${TB_QUEUE_EDGE_NOTIFICATIONS_TOPIC:tb_edge.notifications}"
|
|
# Topic prefix for downlinks to be pushed to specific edge.
|
|
# Every edge has its own unique topic: PREFIX.TENANT_ID.EDGE_ID
|
|
event_notifications_topic: "${TB_QUEUE_EDGE_EVENT_NOTIFICATIONS_TOPIC:tb_edge_event.notifications}"
|
|
# Amount of partitions used by Edge services
|
|
partitions: "${TB_QUEUE_EDGE_PARTITIONS:10}"
|
|
# Poll interval for topics related to Edge services
|
|
poll-interval: "${TB_QUEUE_EDGE_POLL_INTERVAL_MS:25}"
|
|
# Timeout for processing a message pack by Edge services
|
|
pack-processing-timeout: "${TB_QUEUE_EDGE_PACK_PROCESSING_TIMEOUT_MS:10000}"
|
|
# Retries for processing a failure message pack by Edge services
|
|
pack-processing-retries: "${TB_QUEUE_EDGE_MESSAGE_PROCESSING_RETRIES:3}"
|
|
# Enable/disable a separate consumer per partition for Edge queue
|
|
consumer-per-partition: "${TB_QUEUE_EDGE_CONSUMER_PER_PARTITION:false}"
|
|
stats:
|
|
# Enable/disable statistics for Edge services
|
|
enabled: "${TB_QUEUE_EDGE_STATS_ENABLED:true}"
|
|
# Statistics printing interval for Edge services
|
|
print-interval-ms: "${TB_QUEUE_EDGE_STATS_PRINT_INTERVAL_MS:60000}"
|
|
tasks:
|
|
# Poll interval in milliseconds for tasks topics
|
|
poll_interval: "${TB_QUEUE_TASKS_POLL_INTERVAL_MS:500}"
|
|
# Partitions count for tasks queues
|
|
partitions: "${TB_QUEUE_TASKS_PARTITIONS:12}"
|
|
# Custom partitions count for tasks queues per type. Format: 'TYPE1:24;TYPE2:36', e.g. 'CF_REPROCESSING:24;TENANT_EXPORT:6'
|
|
partitions_per_type: "${TB_QUEUE_TASKS_PARTITIONS_PER_TYPE:}"
|
|
# Tasks partitioning strategy: 'tenant' or 'entity'. By default, using 'tenant' - tasks of a specific tenant are processed in the same partition.
|
|
# In a single-tenant environment, use 'entity' strategy to distribute the tasks among multiple partitions.
|
|
partitioning_strategy: "${TB_QUEUE_TASKS_PARTITIONING_STRATEGY:tenant}"
|
|
stats:
|
|
# Name for the tasks stats topic
|
|
topic: "${TB_QUEUE_TASKS_STATS_TOPIC:jobs.stats}"
|
|
# Poll interval in milliseconds for tasks stats topic
|
|
poll_interval: "${TB_QUEUE_TASKS_STATS_POLL_INTERVAL_MS:500}"
|
|
# Interval in milliseconds to process job stats
|
|
processing_interval: "${TB_QUEUE_TASKS_STATS_PROCESSING_INTERVAL_MS:1000}"
|
|
|
|
# Event configuration parameters
|
|
# Controls limits on debug event content size stored for rule chain and rule node execution.
|
|
event:
|
|
debug:
|
|
# Maximum number of symbols per debug event. The event content will be truncated if needed
|
|
max-symbols: "${TB_MAX_DEBUG_EVENT_SYMBOLS:4096}"
|
|
|
|
# General service parameters
|
|
# Sets the deployment type (monolith or microservice) and assigns tenant profiles to specific Rule Engine instances.
|
|
service:
|
|
type: "${TB_SERVICE_TYPE:monolith}" # monolith or tb-core or tb-rule-engine
|
|
# Unique id for this service (autogenerated if empty)
|
|
id: "${TB_SERVICE_ID:}"
|
|
rule_engine:
|
|
# Comma-separated list of tenant profile ids assigned to this Rule Engine.
|
|
# This Rule Engine will only be responsible for tenants with these profiles (in case 'isolation' option is enabled in the profile).
|
|
assigned_tenant_profiles: "${TB_RULE_ENGINE_ASSIGNED_TENANT_PROFILES:}"
|
|
pubsub:
|
|
# Thread pool size for pubsub rule node executor provider. If not set - default pubsub executor provider value will be used (5 * number of available processors)
|
|
executor_thread_pool_size: "${TB_RULE_ENGINE_PUBSUB_EXECUTOR_THREAD_POOL_SIZE:0}"
|
|
|
|
# Metrics parameters
|
|
# Enables actuator metrics endpoint and configures system info (CPU, memory) persistence frequency and TTL.
|
|
metrics:
|
|
# Enable/disable actuator metrics.
|
|
enabled: "${METRICS_ENABLED:false}"
|
|
timer:
|
|
# Metrics percentiles returned by actuator for timer metrics. List of double values (divided by ,).
|
|
percentiles: "${METRICS_TIMER_PERCENTILES:0.5}"
|
|
system_info:
|
|
# Persist frequency of system info (CPU, memory usage, etc.) in seconds
|
|
persist_frequency: "${METRICS_SYSTEM_INFO_PERSIST_FREQUENCY_SECONDS:60}"
|
|
# TTL in days for system info timeseries
|
|
ttl: "${METRICS_SYSTEM_INFO_TTL_DAYS:7}"
|
|
|
|
# Version control parameters
|
|
# Configures thread pools and Git repository folder for entity version control (export/import) operations.
|
|
vc:
|
|
# Pool size for handling export tasks
|
|
thread_pool_size: "${TB_VC_POOL_SIZE:6}"
|
|
git:
|
|
# Pool size for handling the git IO operations
|
|
io_pool_size: "${TB_VC_GIT_POOL_SIZE:3}"
|
|
# Default storing repository path
|
|
repositories-folder: "${TB_VC_GIT_REPOSITORIES_FOLDER:${java.io.tmpdir}/repositories}"
|
|
|
|
# Notification system parameters
|
|
# Configures thread pool size and deduplication intervals for the notification rule processing engine.
|
|
notification_system:
|
|
# Specify thread pool size for Notification System processing notification rules and notification sending. Recommend value <= 10
|
|
thread_pool_size: "${TB_NOTIFICATION_SYSTEM_THREAD_POOL_SIZE:10}"
|
|
rules:
|
|
# Semicolon-separated deduplication durations (in millis) for trigger types. Format: 'NotificationRuleTriggerType1:123;NotificationRuleTriggerType2:456'
|
|
deduplication_durations: "${TB_NOTIFICATION_RULES_DEDUPLICATION_DURATIONS:NEW_PLATFORM_VERSION:0;RATE_LIMITS:14400000;}"
|
|
|
|
# General management parameters
|
|
# Configures Spring Boot Actuator endpoint exposure and health indicator settings.
|
|
management:
|
|
endpoints:
|
|
web:
|
|
exposure:
|
|
# Expose metrics endpoint (use value 'prometheus' to enable prometheus metrics).
|
|
include: "${METRICS_ENDPOINTS_EXPOSE:info}"
|
|
health:
|
|
elasticsearch:
|
|
# Enable the org.springframework.boot.actuate.elasticsearch.ElasticsearchRestClientHealthIndicator.doHealthCheck
|
|
enabled: "false"
|
|
|
|
# Mobile application settings for Thingsboard mobile application
|
|
# Specifies domain name and store links used for the ThingsBoard Live mobile application QR code and deep links.
|
|
mobileApp:
|
|
# Server domain name for Thingsboard Live mobile application
|
|
domain: "${TB_MOBILE_APP_DOMAIN:demo.thingsboard.io}"
|
|
# Link to Google Play store for Thingsboard Live mobile application
|
|
googlePlayLink: "${TB_MOBILE_APP_GOOGLE_PLAY_LINK:https://play.google.com/store/apps/details?id=org.thingsboard.demo.app}"
|
|
# Link to App Store for Thingsboard Live mobile application
|
|
appStoreLink: "${TB_MOBILE_APP_APP_STORE_LINK:https://apps.apple.com/us/app/thingsboard-live/id1594355695}"
|
|
|
|
# MQTT client parameters
|
|
# Configures MQTT client retransmission behavior including max attempts, initial delay, and jitter factor.
|
|
mqtt:
|
|
# MQTT client configuration parameters
|
|
client:
|
|
# Parameters that control the retransmission mechanism.
|
|
# This mechanism only applies to the handling of MQTT Publish, Subscribe, Unsubscribe and Pubrel messages.
|
|
# With the updated default settings:
|
|
# - After sending the message, wait approximately 5000 ms (± jitter) for the 1st attempt.
|
|
# - The 2nd attempt will occur after roughly 5000 * 2 = 10,000 ms (± jitter).
|
|
# - The 3rd attempt will occur after roughly 5000 * 4 = 20,000 ms (± jitter).
|
|
# - The 4th "attempt" will not actually perform a retransmission.
|
|
# Instead, the system will detect that the maximum number of attempts has been reached and drop the pending message.
|
|
retransmission:
|
|
# Maximum number of retransmission attempts allowed.
|
|
# If the attempt count exceeds this value, retransmissions will stop and the pending message will be dropped.
|
|
max_attempts: "${TB_MQTT_CLIENT_RETRANSMISSION_MAX_ATTEMPTS:3}"
|
|
# Base delay (in milliseconds) before the first retransmission attempt, measured from the moment the message is sent.
|
|
# Subsequent delays are calculated using exponential backoff.
|
|
# This base delay is also used as the reference value for applying jitter.
|
|
initial_delay_millis: "${TB_MQTT_CLIENT_RETRANSMISSION_INITIAL_DELAY_MILLIS:5000}"
|
|
# Jitter factor applied to the calculated retransmission delay.
|
|
# The actual delay is randomized within a range defined by multiplying the base delay by a factor between (1 - jitter_factor) and (1 + jitter_factor).
|
|
# For example, a jitter_factor of 0.15 means the actual delay may vary by up to ±15% of the base delay.
|
|
jitter_factor: "${TB_MQTT_CLIENT_RETRANSMISSION_JITTER_FACTOR:0.15}"
|
|
|