dashboardjavacloudcoapiotiot-analyticsiot-platformiot-solutionskafkalwm2mmicroservicesmiddlewaremqttnettyplatformsnmpthingsboardvisualizationwebsocketswidgets
You can not select more than 25 topics
Topics must start with a letter or number, can include dashes ('-') and can be up to 35 characters long.
5 lines
367 B
5 lines
367 B
--PostgreSQL specific truncate to fit constraints
|
|
TRUNCATE TABLE device_credentials, device, device_profile, asset, asset_profile, ota_package, rule_node_state, rule_node, rule_chain, alarm_comment, alarm, entity_alarm;
|
|
|
|
-- Decrease seq_id column to make sure to cover cases of new sequential cycle during the tests
|
|
ALTER SEQUENCE edge_event_seq_id_seq MAXVALUE 256;
|
|
|